BLASTX nr result
ID: Mentha26_contig00008479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00008479 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28168.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002285069.1| PREDICTED: nudix hydrolase 19, chloroplastic... 67 3e-09 >emb|CBI28168.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 ELTPMFIPGPFAIAHHLISSWVNQVPVNGVEAQ 99 EL MFIPGPFAIAHHLISSWVNQVP+NGVEAQ Sbjct: 282 ELATMFIPGPFAIAHHLISSWVNQVPLNGVEAQ 314 >ref|XP_002285069.1| PREDICTED: nudix hydrolase 19, chloroplastic-like [Vitis vinifera] Length = 441 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 ELTPMFIPGPFAIAHHLISSWVNQVPVNGVEAQ 99 EL MFIPGPFAIAHHLISSWVNQVP+NGVEAQ Sbjct: 398 ELATMFIPGPFAIAHHLISSWVNQVPLNGVEAQ 430