BLASTX nr result
ID: Mentha26_contig00008304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00008304 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29510.1| hypothetical protein MIMGU_mgv1a013842mg [Mimulus... 57 2e-06 >gb|EYU29510.1| hypothetical protein MIMGU_mgv1a013842mg [Mimulus guttatus] Length = 209 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%) Frame = -2 Query: 190 HYYNKAGGFRTNFPSSSL-GKSHHNNSISTRNSAT---RRAVISSVLGRKVKKENVIPDP 23 ++Y+K G + + L GK + S+STRNS RRAV+SS LG+ VKK +IP+P Sbjct: 16 NHYDKVGVSGSQSSHNLLSGKFMYTFSLSTRNSGIAPRRRAVVSSALGKGVKKRTIIPEP 75 Query: 22 DYRIPIV 2 DYRIPIV Sbjct: 76 DYRIPIV 82