BLASTX nr result
ID: Mentha26_contig00008275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00008275 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31097.1| hypothetical protein MIMGU_mgv1a002083mg [Mimulus... 58 1e-06 >gb|EYU31097.1| hypothetical protein MIMGU_mgv1a002083mg [Mimulus guttatus] Length = 718 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 258 MDMASKLQFLDLRSTFITGATPLSHSFPAALXAQNHS 148 MD+ASK+QF+DLRSTF+ G TPLSHSFPAAL + S Sbjct: 1 MDLASKIQFMDLRSTFLAGTTPLSHSFPAALRPHHRS 37