BLASTX nr result
ID: Mentha26_contig00008036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00008036 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320682.1| Calcium-transporting ATPase 3 family protein... 72 8e-11 ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transport... 71 2e-10 ref|XP_002510078.1| cation-transporting atpase, putative [Ricinu... 71 2e-10 ref|XP_004501511.1| PREDICTED: calcium-transporting ATPase 3, en... 70 2e-10 gb|EYU36392.1| hypothetical protein MIMGU_mgv1a000823mg [Mimulus... 70 4e-10 ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, en... 69 7e-10 ref|XP_004290983.1| PREDICTED: calcium-transporting ATPase 3, en... 67 2e-09 ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, en... 67 3e-09 gb|ACJ86234.1| unknown [Medicago truncatula] 67 3e-09 ref|XP_003524018.1| PREDICTED: calcium-transporting ATPase 3, en... 66 4e-09 emb|CBI19381.3| unnamed protein product [Vitis vinifera] 65 8e-09 ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [A... 64 2e-08 ref|XP_006651781.1| PREDICTED: calcium-transporting ATPase 3, en... 63 5e-08 gb|AAO38471.1| putative P-type ATPase [Oryza sativa Japonica Group] 63 5e-08 gb|EEE59867.1| hypothetical protein OsJ_12452 [Oryza sativa Japo... 63 5e-08 gb|ABF98693.1| Calcium-transporting ATPase 3, endoplasmic reticu... 63 5e-08 ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, en... 62 6e-08 ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, en... 62 6e-08 ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citr... 62 6e-08 gb|EEC76121.1| hypothetical protein OsI_13389 [Oryza sativa Indi... 60 2e-07 >ref|XP_002320682.1| Calcium-transporting ATPase 3 family protein [Populus trichocarpa] gi|222861455|gb|EEE98997.1| Calcium-transporting ATPase 3 family protein [Populus trichocarpa] Length = 1015 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDEILKFFSR+S G R LR RR DLLPKRE+RDK Sbjct: 973 YLSFPVIIIDEILKFFSRNSTGLRLGLRFRRPDLLPKRELRDK 1015 >ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] gi|508723793|gb|EOY15690.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] Length = 1001 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDE+LKFFSR+S G RFN R RR D LPK+E+RDK Sbjct: 959 YLSFPVIIIDEVLKFFSRNSYGIRFNFRFRRFDALPKKELRDK 1001 >ref|XP_002510078.1| cation-transporting atpase, putative [Ricinus communis] gi|223550779|gb|EEF52265.1| cation-transporting atpase, putative [Ricinus communis] Length = 987 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDEILKFFSR++ G RF R RR DLLPKRE RDK Sbjct: 945 YLSFPVIIIDEILKFFSRNANGIRFRFRFRRPDLLPKRESRDK 987 >ref|XP_004501511.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Cicer arietinum] Length = 1005 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLS PVIIIDEILKFFSR+ G RF L RRSDLLPKREVRDK Sbjct: 963 YLSLPVIIIDEILKFFSRNPNGLRFRLWFRRSDLLPKREVRDK 1005 >gb|EYU36392.1| hypothetical protein MIMGU_mgv1a000823mg [Mimulus guttatus] Length = 971 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVI+IDEILKFFSR+ G RFN R RR+DLLPK+EV D+ Sbjct: 929 YLSFPVILIDEILKFFSRNPTGLRFNFRFRRTDLLPKQEVHDR 971 >ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Solanum lycopersicum] Length = 1000 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVI+IDEILKFFSR S G RF+ R RR+DLLPKRE+RDK Sbjct: 959 YLSFPVILIDEILKFFSRHS-GIRFSFRFRRADLLPKREIRDK 1000 >ref|XP_004290983.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Fragaria vesca subsp. vesca] Length = 1001 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDE+LKFFSR + G R N LRR DLLP++E+RDK Sbjct: 959 YLSFPVIIIDEVLKFFSRSTTGLRLNFLLRRHDLLPRKELRDK 1001 >ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Solanum tuberosum] Length = 1000 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVI+IDEILKF SR+S G RF+ R RR+DLLPKRE+RDK Sbjct: 959 YLSFPVILIDEILKFVSRNS-GIRFSFRFRRADLLPKREIRDK 1000 >gb|ACJ86234.1| unknown [Medicago truncatula] Length = 413 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLS PVIIIDEILKFFSR+ G R L RR+DLLPKREVRDK Sbjct: 371 YLSLPVIIIDEILKFFSRNPSGLRLRLWFRRTDLLPKREVRDK 413 >ref|XP_003524018.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoformX1 [Glycine max] Length = 1001 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLS PVI+IDE+LKFFSR+ G RF L RRSDLLPK+E+RDK Sbjct: 959 YLSLPVIVIDEVLKFFSRNPIGLRFRLWFRRSDLLPKKELRDK 1001 >emb|CBI19381.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 65.5 bits (158), Expect = 8e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDE+LKFFSR+S G RFN R RR D+LPK E+RDK Sbjct: 959 YLSFPVIIIDEVLKFFSRNSCGTRFNFRFRRPDVLPK-ELRDK 1000 >ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] gi|548861203|gb|ERN18587.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] Length = 1001 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 6 LSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 LSFPVIIIDEILK SR+ RG RFNLR + DLLPKRE+RD+ Sbjct: 960 LSFPVIIIDEILKLLSRNVRGRRFNLRFGKRDLLPKREIRDR 1001 >ref|XP_006651781.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Oryza brachyantha] Length = 1000 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRD 128 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK E RD Sbjct: 959 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK-ESRD 999 >gb|AAO38471.1| putative P-type ATPase [Oryza sativa Japonica Group] Length = 747 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRD 128 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK E RD Sbjct: 706 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK-ESRD 746 >gb|EEE59867.1| hypothetical protein OsJ_12452 [Oryza sativa Japonica Group] Length = 1082 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRD 128 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK E RD Sbjct: 1041 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK-ESRD 1081 >gb|ABF98693.1| Calcium-transporting ATPase 3, endoplasmic reticulum-type, putative, expressed [Oryza sativa Japonica Group] Length = 1058 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRD 128 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK E RD Sbjct: 1017 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK-ESRD 1057 >ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X2 [Citrus sinensis] Length = 992 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDE+LKFFSR S G RF RR D+LPK+E +K Sbjct: 950 YLSFPVIIIDEVLKFFSRKSSGMRFKFWFRRHDILPKKEFHEK 992 >ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Citrus sinensis] Length = 1001 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDE+LKFFSR S G RF RR D+LPK+E +K Sbjct: 959 YLSFPVIIIDEVLKFFSRKSSGMRFKFWFRRHDILPKKEFHEK 1001 >ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] gi|557535774|gb|ESR46892.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] Length = 1001 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 131 YLSFPVIIIDE+LKFFSR S G RF RR D+LPK+E +K Sbjct: 959 YLSFPVIIIDEVLKFFSRKSSGMRFKFWFRRHDILPKKEFHEK 1001 >gb|EEC76121.1| hypothetical protein OsI_13389 [Oryza sativa Indica Group] Length = 1076 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRD 128 YLSFPVI+IDE+LKF SR SRG RF LRLRR ++LPK E RD Sbjct: 1035 YLSFPVILIDEVLKFLSRSSRGRRFPLRLRRREILPK-ESRD 1075