BLASTX nr result
ID: Mentha26_contig00007992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00007992 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44362.1| hypothetical protein MIMGU_mgv1a011854mg [Mimulus... 58 2e-06 >gb|EYU44362.1| hypothetical protein MIMGU_mgv1a011854mg [Mimulus guttatus] Length = 268 Score = 57.8 bits (138), Expect = 2e-06 Identities = 38/75 (50%), Positives = 47/75 (62%) Frame = +3 Query: 150 MILSGSCLNSGVSSLLPYNRNPCNFKTCNSRISSIHPTHKRVVPSNHRSSIGPLPEIKSS 329 MILSG SGV LPY+R C+F++ NS IS I +VV RSS P +IKS Sbjct: 1 MILSGC---SGVFHSLPYSRKSCSFRSYNSSISDI----PKVVSFYDRSSCIPHLQIKSP 53 Query: 330 ASLGFPNFHLSAASS 374 ASLG +FHLS+AS+ Sbjct: 54 ASLGLHHFHLSSAST 68