BLASTX nr result
ID: Mentha26_contig00007573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00007573 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19502.1| hypothetical protein MIMGU_mgv1a002762mg [Mimulus... 59 9e-07 >gb|EYU19502.1| hypothetical protein MIMGU_mgv1a002762mg [Mimulus guttatus] Length = 640 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +1 Query: 100 MALISIASRPSSLFSRKL-RNCGANDSLLAHSVKSISFFNPIPLFSNLSFKN 252 MAL SI SRPSS SR L +N A+DS + ++SISF NPIPLFSN+SF N Sbjct: 1 MALNSILSRPSSFSSRNLLKNYSASDSAFSLPIQSISFLNPIPLFSNVSFNN 52