BLASTX nr result
ID: Mentha26_contig00007273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00007273 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43351.1| hypothetical protein MIMGU_mgv1a015384mg [Mimulus... 95 1e-17 ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutr... 92 7e-17 ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Caps... 92 7e-17 ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana... 92 7e-17 ref|XP_002890790.1| ribosomal protein L34 family protein [Arabid... 92 7e-17 sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, ... 91 2e-16 ref|XP_006346545.1| PREDICTED: 50S ribosomal protein L34, chloro... 90 3e-16 ref|XP_004229053.1| PREDICTED: 50S ribosomal protein L34, chloro... 90 3e-16 emb|CBI30669.3| unnamed protein product [Vitis vinifera] 90 3e-16 ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloro... 90 3e-16 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 90 3e-16 ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloro... 90 4e-16 ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloro... 89 5e-16 ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citr... 89 5e-16 ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prun... 89 6e-16 ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloro... 89 6e-16 ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] ... 88 1e-15 ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precu... 86 7e-15 gb|EXB44996.1| 50S ribosomal protein L34 [Morus notabilis] 84 3e-14 ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Popu... 84 3e-14 >gb|EYU43351.1| hypothetical protein MIMGU_mgv1a015384mg [Mimulus guttatus] Length = 159 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFRKRMSTT GRA+I+RRR+KGRW LCTKTNP SGKRA Sbjct: 107 KRNRSRKSLARTHGFRKRMSTTRGRAVIQRRRAKGRWILCTKTNPISGKRA 157 >ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] gi|557093385|gb|ESQ33967.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] Length = 160 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KR+RSRKSLARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 110 KRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 160 >ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] gi|482572095|gb|EOA36282.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] Length = 156 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KR+RSRKSLARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 106 KRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 156 >ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana] gi|75311421|sp|Q9LP37.1|RK34_ARATH RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|9502428|gb|AAF88127.1|AC021043_20 Putative ribosomal protein L34 [Arabidopsis thaliana] gi|17380840|gb|AAL36232.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|20259639|gb|AAM14176.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|21536900|gb|AAM61232.1| plastid ribosomal protein L34 precursor, putative [Arabidopsis thaliana] gi|332192918|gb|AEE31039.1| 50S ribosomal protein L34 [Arabidopsis thaliana] Length = 157 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KR+RSRKSLARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 107 KRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 157 >ref|XP_002890790.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] gi|297336632|gb|EFH67049.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] Length = 159 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KR+RSRKSLARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 109 KRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 159 >sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|189096152|pdb|3BBO|4 Chain 4, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7578860|gb|AAF64157.1|AF238221_1 plastid ribosomal protein L34 precursor [Spinacia oleracea] Length = 152 Score = 90.9 bits (224), Expect = 2e-16 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KR+RSRKSLARTHGFR RMSTTSGRAL+KRRR+KGR LCTKTNPSSGKRA Sbjct: 100 KRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGRKILCTKTNPSSGKRA 150 >ref|XP_006346545.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565359499|ref|XP_006346546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 156 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFRKRMSTTSGRA I+RRR+KGRW LC K++P +GKRA Sbjct: 106 KRNRSRKSLARTHGFRKRMSTTSGRATIQRRRAKGRWDLCPKSSPRTGKRA 156 >ref|XP_004229053.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Solanum lycopersicum] Length = 156 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFRKRMSTTSGRA I+RRR+KGRW LC K++P +GKRA Sbjct: 106 KRNRSRKSLARTHGFRKRMSTTSGRATIQRRRAKGRWDLCPKSSPRTGKRA 156 >emb|CBI30669.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 63 KRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 113 >ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Vitis vinifera] Length = 148 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 98 KRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 148 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 98 KRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 148 >ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 150 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRN+SRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTKTNP+SGKRA Sbjct: 100 KRNKSRKSLARTHGFRRRMRTTSGRAMLKRRRAKGRKVLCTKTNPNSGKRA 150 >ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Citrus sinensis] Length = 161 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGRW LC K+ P+SGKRA Sbjct: 111 KRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 161 >ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|567914339|ref|XP_006449483.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552093|gb|ESR62722.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552094|gb|ESR62723.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] Length = 161 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGRW LC K+ P+SGKRA Sbjct: 111 KRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 161 >ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] gi|462407923|gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] Length = 209 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TT GRA++KRRR+KGR LCTKTNP+SGKRA Sbjct: 159 KRNRSRKSLARTHGFRRRMRTTGGRAMLKRRRAKGRKILCTKTNPNSGKRA 209 >ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] gi|449479241|ref|XP_004155546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] Length = 155 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TT+GRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 105 KRNRSRKSLARTHGFRRRMRTTNGRAVLKRRRAKGRKVLCTKSNPSSGKRA 155 >ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] gi|508780782|gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 295 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGKR+ Sbjct: 108 KRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGKRS 158 >ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] gi|223538249|gb|EEF39858.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] Length = 161 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 301 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGK Sbjct: 111 KRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 159 >gb|EXB44996.1| 50S ribosomal protein L34 [Morus notabilis] Length = 156 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 301 KRNRSRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTK+ PSSGK Sbjct: 106 KRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRRVLCTKSYPSSGK 154 >ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] gi|550327876|gb|EEE98039.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] Length = 160 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -3 Query: 447 KRNRSRKSLARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 301 KR+RSRKSLARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGK Sbjct: 110 KRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 158