BLASTX nr result
ID: Mentha26_contig00007085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00007085 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42432.1| hypothetical protein MIMGU_mgv1a025463mg [Mimulus... 56 5e-06 >gb|EYU42432.1| hypothetical protein MIMGU_mgv1a025463mg [Mimulus guttatus] Length = 648 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 265 MHTRYMERTNSMKGGGKRSLEDDGGNEEKQEPDKK 369 M TRYMERTNSMKG GKRSLE+ +EE+QEP++K Sbjct: 1 MQTRYMERTNSMKGRGKRSLEEGAADEEQQEPERK 35