BLASTX nr result
ID: Mentha26_contig00006981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00006981 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27027.1| hypothetical protein MIMGU_mgv1a011748mg [Mimulus... 62 6e-08 >gb|EYU27027.1| hypothetical protein MIMGU_mgv1a011748mg [Mimulus guttatus] Length = 272 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/46 (67%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = -2 Query: 131 KTENFGVSAKGSSPNGPLVEP---PEFPYSYAPANPNGSTVVRFVQ 3 K+ENF VS GSSP P VEP PE PYSYA ANPNGS VV+F+Q Sbjct: 43 KSENFSVSGNGSSPKAPFVEPSKQPESPYSYALANPNGSPVVQFMQ 88