BLASTX nr result
ID: Mentha26_contig00006472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00006472 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplast... 91 2e-16 gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum] 91 2e-16 gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precu... 89 5e-16 sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chlo... 89 8e-16 ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme... 88 1e-15 ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme... 88 1e-15 gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata] 88 1e-15 ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [So... 88 1e-15 emb|CAB72423.1| glutamine synthetase [Brassica napus] 88 1e-15 gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata] 88 1e-15 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chlo... 88 1e-15 emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassi... 88 1e-15 gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa s... 88 1e-15 gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea] 88 1e-15 pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco 87 2e-15 gb|AAN84563.1| glutamine synthetase [Lotus japonicus] 87 2e-15 gb|AAA50249.1| glutamine synthetase, partial (chloroplast) [Sola... 87 2e-15 gb|AAX35343.1| glutamine synthetase [Cucumis melo] 87 2e-15 ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinu... 87 2e-15 ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme... 87 2e-15 >ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum] Length = 432 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVTGLLAETT+LWEPTLEAEALAAQKISLKV Sbjct: 388 YLEDRRPASNMDPYVVTGLLAETTILWEPTLEAEALAAQKISLKV 432 >gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum] Length = 432 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVTGLLAETT+LWEPTLEAEALAAQKISLKV Sbjct: 388 YLEDRRPASNMDPYVVTGLLAETTILWEPTLEAEALAAQKISLKV 432 >gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum crystallinum] Length = 433 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKI++KV Sbjct: 389 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKIAMKV 433 >sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|2454633|gb|AAB71693.1| glutamine synthetase [Daucus carota] Length = 432 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQK+SL V Sbjct: 388 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKLSLNV 432 >ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, partial [Cucumis sativus] Length = 249 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETTLLWEPTLEAEALAAQK+SLKV Sbjct: 205 YLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLSLKV 249 >ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like [Cucumis sativus] Length = 432 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETTLLWEPTLEAEALAAQK+SLKV Sbjct: 388 YLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLSLKV 432 >gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata] Length = 429 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETTLLWEPTLEAEALAAQK+SLKV Sbjct: 385 YLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLSLKV 429 >ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum] gi|209529860|gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum] Length = 432 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETT+LWEPTLEAEALAAQKISLKV Sbjct: 388 YLEDRRPASNMDPYVVTALLAETTILWEPTLEAEALAAQKISLKV 432 >emb|CAB72423.1| glutamine synthetase [Brassica napus] Length = 428 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLKV Sbjct: 384 YLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLKV 428 >gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata] Length = 430 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETTLLWEPTLEAEALAAQKI+LKV Sbjct: 386 YLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKIALKV 430 >sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|296223|emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus] Length = 428 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLKV Sbjct: 384 YLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLKV 428 >emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus] Length = 428 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLKV Sbjct: 384 YLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLKV 428 >gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis] Length = 428 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPY+VT LLAETTLLWEPTLEAEALAAQK+SLKV Sbjct: 384 YLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLSLKV 428 >gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea] Length = 431 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVTGLLAETT+LWEPTLEAEALAAQK+SL V Sbjct: 387 YLEDRRPASNMDPYVVTGLLAETTILWEPTLEAEALAAQKLSLNV 431 >pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco Length = 432 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVTGLLA+TT+LWEPTLEAEALAAQK++LKV Sbjct: 388 YLEDRRPASNMDPYVVTGLLAQTTILWEPTLEAEALAAQKLALKV 432 >gb|AAN84563.1| glutamine synthetase [Lotus japonicus] Length = 430 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETTLLWEPTLEAEALAAQKI LKV Sbjct: 386 YLEDRRPASNMDPYVVTALLAETTLLWEPTLEAEALAAQKIQLKV 430 >gb|AAA50249.1| glutamine synthetase, partial (chloroplast) [Solanum lycopersicum] Length = 191 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDP VVTGLLAETT+LWEPTLEAEALAAQKISLKV Sbjct: 147 YLEDRRPASNMDPIVVTGLLAETTILWEPTLEAEALAAQKISLKV 191 >gb|AAX35343.1| glutamine synthetase [Cucumis melo] Length = 432 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETT+LWEPTLEAEALAAQK+SLKV Sbjct: 388 YLEDRRPASNMDPYVVTSLLAETTILWEPTLEAEALAAQKLSLKV 432 >ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis] gi|223543889|gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis] Length = 432 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETT+LWEPTLEAEALAAQK+SLKV Sbjct: 388 YLEDRRPASNMDPYVVTSLLAETTILWEPTLEAEALAAQKLSLKV 432 >ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis vinifera] gi|296086690|emb|CBI32325.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 334 YLEDRRPASNMDPYVVTGLLAETTLLWEPTLEAEALAAQKISLKV 200 YLEDRRPASNMDPYVVT LLAETT+LWEPTLEAEALAAQK+SLKV Sbjct: 389 YLEDRRPASNMDPYVVTSLLAETTILWEPTLEAEALAAQKLSLKV 433