BLASTX nr result
ID: Mentha26_contig00005945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005945 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25244.1| hypothetical protein MIMGU_mgv1a018491mg [Mimulus... 67 3e-09 >gb|EYU25244.1| hypothetical protein MIMGU_mgv1a018491mg [Mimulus guttatus] Length = 383 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/49 (63%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +3 Query: 6 ANSSSYVVGSLEKLHVFMLYLFGLLVLAFQYLRRGMMRLKPMKV-EALT 149 A+SSS++V S+EKLH+F++Y FGL VLAF+Y+RRG+ RLKP++V ALT Sbjct: 335 ASSSSFIVESVEKLHIFLVYFFGLFVLAFEYIRRGVRRLKPVRVGSALT 383