BLASTX nr result
ID: Mentha26_contig00005891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005891 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19704.1| hypothetical protein MIMGU_mgv1a006312mg [Mimulus... 51 6e-06 >gb|EYU19704.1| hypothetical protein MIMGU_mgv1a006312mg [Mimulus guttatus] Length = 449 Score = 51.2 bits (121), Expect(2) = 6e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +2 Query: 242 KHQLKRALLAEDSAFASLKGNGHGHSMTFFEFCEALQQFS 361 KHQL+RAL+ ED AFA LK N HGH +T+ F EAL Q + Sbjct: 298 KHQLRRALVTEDDAFAFLKANSHGHYITYSGFYEALCQLN 337 Score = 24.3 bits (51), Expect(2) = 6e-06 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 175 HDAAHLYTNAHAHKCLTVSN 234 +DAAHLYT+ A K ++ N Sbjct: 243 YDAAHLYTDTDAQKWVSHRN 262