BLASTX nr result
ID: Mentha26_contig00005872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005872 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK92493.1| unknown [Populus trichocarpa] 67 2e-09 ref|XP_007045119.1| NHL domain-containing protein [Theobroma cac... 67 3e-09 ref|XP_004298463.1| PREDICTED: uncharacterized protein LOC101315... 67 3e-09 ref|XP_007223327.1| hypothetical protein PRUPE_ppa007345mg [Prun... 67 3e-09 gb|EXC04504.1| hypothetical protein L484_001669 [Morus notabilis] 66 6e-09 ref|XP_006369005.1| hypothetical protein POPTR_0001s15630g [Popu... 65 8e-09 ref|XP_002533816.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_004238842.1| PREDICTED: uncharacterized protein LOC101254... 64 2e-08 ref|XP_006344233.1| PREDICTED: uncharacterized protein LOC102581... 64 3e-08 gb|EPS67311.1| hypothetical protein M569_07462 [Genlisea aurea] 63 4e-08 ref|XP_006381268.1| hypothetical protein POPTR_0006s11230g [Popu... 63 4e-08 ref|XP_006360415.1| PREDICTED: uncharacterized protein LOC102580... 63 5e-08 ref|XP_006469161.1| PREDICTED: uncharacterized protein LOC102629... 62 6e-08 ref|XP_006448280.1| hypothetical protein CICLE_v10015653mg [Citr... 62 6e-08 ref|XP_006448279.1| hypothetical protein CICLE_v10015653mg [Citr... 62 6e-08 ref|XP_002284260.1| PREDICTED: uncharacterized protein LOC100245... 62 6e-08 emb|CBI26912.3| unnamed protein product [Vitis vinifera] 62 6e-08 emb|CAN76514.1| hypothetical protein VITISV_019361 [Vitis vinifera] 62 6e-08 ref|XP_004498321.1| PREDICTED: uncharacterized protein LOC101508... 62 8e-08 ref|XP_007136776.1| hypothetical protein PHAVU_009G073100g [Phas... 60 2e-07 >gb|ABK92493.1| unknown [Populus trichocarpa] Length = 369 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV SE E +DEK+W++VLIGLGL YFLIWRFQM+ +V++++KK Sbjct: 325 EVRSEKENEDEKMWVYVLIGLGLAYFLIWRFQMKQLVKNMDKK 367 >ref|XP_007045119.1| NHL domain-containing protein [Theobroma cacao] gi|508709054|gb|EOY00951.1| NHL domain-containing protein [Theobroma cacao] Length = 370 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +1 Query: 1 VEVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKKI 135 VEV SE E +E VW+FVL+GLGL YFL WRFQMR +V++++KKI Sbjct: 325 VEVRSEKESGEEHVWVFVLVGLGLAYFLFWRFQMRQLVKNMDKKI 369 >ref|XP_004298463.1| PREDICTED: uncharacterized protein LOC101315233 [Fragaria vesca subsp. vesca] Length = 367 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV SE E K+E VWI+VL+GLGL YF++WRFQMR +V ++NKK Sbjct: 323 EVRSEKESKEETVWIYVLVGLGLAYFMVWRFQMRQLVGNMNKK 365 >ref|XP_007223327.1| hypothetical protein PRUPE_ppa007345mg [Prunus persica] gi|462420263|gb|EMJ24526.1| hypothetical protein PRUPE_ppa007345mg [Prunus persica] Length = 371 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV S E K+E VWIFVLIGLGL YFL WRFQMR +V +LNKK Sbjct: 327 EVRSVKESKEESVWIFVLIGLGLAYFLFWRFQMRQLVGNLNKK 369 >gb|EXC04504.1| hypothetical protein L484_001669 [Morus notabilis] Length = 374 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV SE E K+E VWIFVL+GLGL YFL WRFQMR ++ +++KK Sbjct: 330 EVRSEKENKEESVWIFVLVGLGLAYFLFWRFQMRKLIANMDKK 372 >ref|XP_006369005.1| hypothetical protein POPTR_0001s15630g [Populus trichocarpa] gi|550347364|gb|ERP65574.1| hypothetical protein POPTR_0001s15630g [Populus trichocarpa] Length = 369 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV SE E +DEK+W++VLIGLGL YFLIWRFQM+ + ++++KK Sbjct: 325 EVRSEKENEDEKMWVYVLIGLGLAYFLIWRFQMKQLFKNMDKK 367 >ref|XP_002533816.1| conserved hypothetical protein [Ricinus communis] gi|223526253|gb|EEF28569.1| conserved hypothetical protein [Ricinus communis] Length = 363 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 E++S E KDE +WIFVL+GLGL YFL WRFQM+ +VQ+++KK Sbjct: 319 EIKSVRESKDENLWIFVLLGLGLAYFLFWRFQMKQLVQNMDKK 361 >ref|XP_004238842.1| PREDICTED: uncharacterized protein LOC101254087 [Solanum lycopersicum] Length = 368 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKKI 135 EVESE E ++E +W+++LIG+GL F IWRFQM +V+SLNKKI Sbjct: 324 EVESEKESEEEPIWLYILIGIGLFIFFIWRFQMHKLVESLNKKI 367 >ref|XP_006344233.1| PREDICTED: uncharacterized protein LOC102581504 [Solanum tuberosum] Length = 370 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EVESE E ++E VW+++LIG+GL F IWRFQM +V+SLNKK Sbjct: 326 EVESEKESEEEPVWLYILIGIGLFIFFIWRFQMHRLVESLNKK 368 >gb|EPS67311.1| hypothetical protein M569_07462 [Genlisea aurea] Length = 339 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +1 Query: 1 VEVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 VE+ S+VE K++ +WIF+LIGLGL YF WR QM+ ++Q++NKK Sbjct: 294 VELVSQVESKEDNLWIFILIGLGLAYFTFWRLQMKKLIQNMNKK 337 >ref|XP_006381268.1| hypothetical protein POPTR_0006s11230g [Populus trichocarpa] gi|550335969|gb|ERP59065.1| hypothetical protein POPTR_0006s11230g [Populus trichocarpa] Length = 362 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV SE E +DEK+W++VLIGLGL F IWRFQM+ ++++++KK Sbjct: 318 EVRSEKESEDEKIWVYVLIGLGLAIFFIWRFQMKQLIRNMDKK 360 >ref|XP_006360415.1| PREDICTED: uncharacterized protein LOC102580128 [Solanum tuberosum] Length = 369 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/46 (56%), Positives = 38/46 (82%) Frame = +1 Query: 1 VEVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKKIA 138 VE+E E E K++ +W+FVL+G GL YFL WRFQMR +VQ+++K++A Sbjct: 325 VEIE-ENEDKEDNIWLFVLVGFGLTYFLFWRFQMRRLVQNMDKRVA 369 >ref|XP_006469161.1| PREDICTED: uncharacterized protein LOC102629240 [Citrus sinensis] Length = 374 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV S+ E ++E VW+FVL+GLGL YFL WRFQM +V+ +NKK Sbjct: 330 EVRSKKENEEENVWVFVLLGLGLAYFLFWRFQMSKLVRDINKK 372 >ref|XP_006448280.1| hypothetical protein CICLE_v10015653mg [Citrus clementina] gi|557550891|gb|ESR61520.1| hypothetical protein CICLE_v10015653mg [Citrus clementina] Length = 374 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV S+ E ++E VW+FVL+GLGL YFL WRFQM +V+ +NKK Sbjct: 330 EVRSKKENEEENVWVFVLLGLGLAYFLFWRFQMSKLVRDINKK 372 >ref|XP_006448279.1| hypothetical protein CICLE_v10015653mg [Citrus clementina] gi|557550890|gb|ESR61519.1| hypothetical protein CICLE_v10015653mg [Citrus clementina] Length = 308 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 EV S+ E ++E VW+FVL+GLGL YFL WRFQM +V+ +NKK Sbjct: 264 EVRSKKENEEENVWVFVLLGLGLAYFLFWRFQMSKLVRDINKK 306 >ref|XP_002284260.1| PREDICTED: uncharacterized protein LOC100245798 [Vitis vinifera] Length = 366 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 E+ SE E +EK+W++VL+GLGL YFL WRFQM+ ++++L+KK Sbjct: 322 EIRSERESGEEKIWVYVLVGLGLSYFLFWRFQMKQLIKNLDKK 364 >emb|CBI26912.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 E+ SE E +EK+W++VL+GLGL YFL WRFQM+ ++++L+KK Sbjct: 321 EIRSERESGEEKIWVYVLVGLGLSYFLFWRFQMKQLIKNLDKK 363 >emb|CAN76514.1| hypothetical protein VITISV_019361 [Vitis vinifera] Length = 365 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKK 132 E+ SE E +EK+W++VL+GLGL YFL WRFQM+ ++++L+KK Sbjct: 321 EIRSERESGEEKIWVYVLVGLGLSYFLFWRFQMKQLIKNLDKK 363 >ref|XP_004498321.1| PREDICTED: uncharacterized protein LOC101508135 [Cicer arietinum] Length = 370 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKKI 135 EV S E +DE VWI+V+IG GLVYFL WRFQM +V++++KKI Sbjct: 326 EVRSPKESEDENVWIYVMIGFGLVYFLYWRFQMGQLVKNMDKKI 369 >ref|XP_007136776.1| hypothetical protein PHAVU_009G073100g [Phaseolus vulgaris] gi|561009863|gb|ESW08770.1| hypothetical protein PHAVU_009G073100g [Phaseolus vulgaris] Length = 371 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = +1 Query: 4 EVESEVEGKDEKVWIFVLIGLGLVYFLIWRFQMRHVVQSLNKKI 135 EV S E + E VW++V++G+GL YFL WRFQM+ +V ++NKKI Sbjct: 327 EVRSPKESEGENVWMYVMVGIGLAYFLFWRFQMKQLVNNMNKKI 370