BLASTX nr result
ID: Mentha26_contig00005838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005838 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529461.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_007020738.1| LIM and calponin domains-containing protein ... 56 4e-06 emb|CBI26677.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_002529461.1| conserved hypothetical protein [Ricinus communis] gi|223531077|gb|EEF32927.1| conserved hypothetical protein [Ricinus communis] Length = 193 Score = 57.4 bits (137), Expect = 2e-06 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 10/103 (9%) Frame = +1 Query: 1 SVPLRSKFLYFIVNILIVAVGAEAGLLSFFFDSP---RNNKRTSPLKP----HAFISEEK 159 S +R K+LYFI+N+LIVA+GAEAGLLS F P + K P+ H S E+ Sbjct: 26 SSSIRPKYLYFIINLLIVALGAEAGLLSAAFSKPILDHDRKHPVPVSTAQDHHQSSSPEQ 85 Query: 160 LFADQCSNSLVLRCPSEKIVDEE---QKATIKKSASTPSIFFI 279 A +V + SEKIV + +KK S PS+FFI Sbjct: 86 --AKVSKTRVVEKSASEKIVRSSSITKVEKVKKCPSMPSLFFI 126 >ref|XP_007020738.1| LIM and calponin domains-containing protein 1, putative [Theobroma cacao] gi|508720366|gb|EOY12263.1| LIM and calponin domains-containing protein 1, putative [Theobroma cacao] Length = 188 Score = 56.2 bits (134), Expect = 4e-06 Identities = 39/102 (38%), Positives = 57/102 (55%), Gaps = 9/102 (8%) Frame = +1 Query: 1 SVPLRSKFLYFIVNILIVAVGAEAGLLSFF------FDSPRNNKRTSPLKPHAFISEEKL 162 S LR +LYF++N+LI+A+GAEAGLLS F P + T ++ ++KL Sbjct: 26 SSSLRPTYLYFVLNLLIIALGAEAGLLSVFSRPAYVAAKPVTAQETKAVESSK--DDQKL 83 Query: 163 FA---DQCSNSLVLRCPSEKIVDEEQKATIKKSASTPSIFFI 279 A ++ +V + SEKIV + +KK STPS+FFI Sbjct: 84 VAPANNEEKAKVVEKSASEKIVGTVKVDKVKKCPSTPSLFFI 125 >emb|CBI26677.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 40/115 (34%), Positives = 60/115 (52%), Gaps = 22/115 (19%) Frame = +1 Query: 1 SVPLRSKFLYFIV-NILIVAVGAEAGLLSFFFDSPRNNKRTSPLK-------PHAFISEE 156 S LR+ +LYFI+ N+LI+A+GAEAGLLS F P++ K P+ P ++ Sbjct: 26 SSSLRTTYLYFIIINLLIIALGAEAGLLS-FSKPPQDKKYAVPVSAKPLSTPPDQAAPDK 84 Query: 157 KLFADQCSNSLVLRCP--------------SEKIVDEEQKATIKKSASTPSIFFI 279 + ++ L+L P SEKIV + + ++K STPS+FFI Sbjct: 85 EASSNSTDTGLLLTTPERTEKKAKVAEKSASEKIVGAAKLSKVRKCPSTPSLFFI 139