BLASTX nr result
ID: Mentha26_contig00005672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005672 (479 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ16412.1| MYB13, partial [Scutellaria baicalensis] 49 3e-09 gb|EYU17603.1| hypothetical protein MIMGU_mgv1a025007mg [Mimulus... 48 5e-08 gb|EYU33508.1| hypothetical protein MIMGU_mgv1a023961mg, partial... 57 4e-06 >gb|AGZ16412.1| MYB13, partial [Scutellaria baicalensis] Length = 206 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 297 LDGGFILPVLNHSDSISSDVNMLEKVYDEYLQLL 398 L GGFILP+L+HSD DV+ML++VYDEYLQLL Sbjct: 177 LGGGFILPLLSHSD----DVSMLDRVYDEYLQLL 206 Score = 37.7 bits (86), Expect(2) = 3e-09 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +1 Query: 124 KEEASNSKDEDPPRTKVYLPKPIRVSSVFSRTN 222 K+ + + + PP+ KVYLPKPIRVS F R++ Sbjct: 111 KKTNAVTDSDQPPKVKVYLPKPIRVSPAFPRSD 143 >gb|EYU17603.1| hypothetical protein MIMGU_mgv1a025007mg [Mimulus guttatus] Length = 258 Score = 47.8 bits (112), Expect(2) = 5e-08 Identities = 25/35 (71%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +3 Query: 297 LDGGFILPVLNHSDS-ISSDVNMLEKVYDEYLQLL 398 L GG+ILP+L SDS I S+V+MLEKVY+EYLQLL Sbjct: 224 LGGGYILPMLRPSDSLIPSEVDMLEKVYNEYLQLL 258 Score = 35.0 bits (79), Expect(2) = 5e-08 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +1 Query: 136 SNSKDEDPPRTKVYLPKPIRVSSVFS 213 S ++ +PP++KVY+PKP RVS FS Sbjct: 173 SKNESNNPPKSKVYMPKPTRVSPGFS 198 >gb|EYU33508.1| hypothetical protein MIMGU_mgv1a023961mg, partial [Mimulus guttatus] Length = 255 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/33 (84%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 303 GGFILPVLNHS-DSISSDVNMLEKVYDEYLQLL 398 GGF LP+L+HS DSISSDVNMLEKVYDEY+QLL Sbjct: 223 GGFFLPLLHHSGDSISSDVNMLEKVYDEYVQLL 255