BLASTX nr result
ID: Mentha26_contig00005414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005414 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43351.1| hypothetical protein MIMGU_mgv1a015384mg [Mimulus... 80 4e-13 ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutr... 79 7e-13 ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Caps... 79 7e-13 ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana... 79 7e-13 ref|XP_002890790.1| ribosomal protein L34 family protein [Arabid... 79 7e-13 sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, ... 78 1e-12 ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloro... 76 6e-12 ref|XP_006346545.1| PREDICTED: 50S ribosomal protein L34, chloro... 75 9e-12 ref|XP_004229053.1| PREDICTED: 50S ribosomal protein L34, chloro... 75 9e-12 emb|CBI30669.3| unnamed protein product [Vitis vinifera] 75 9e-12 ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloro... 75 9e-12 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 75 9e-12 ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloro... 74 2e-11 ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citr... 74 2e-11 ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prun... 74 2e-11 ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloro... 74 2e-11 ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] ... 73 5e-11 ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Popu... 70 2e-10 ref|XP_003593758.1| 50S ribosomal protein L34 [Medicago truncatu... 70 2e-10 ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precu... 70 2e-10 >gb|EYU43351.1| hypothetical protein MIMGU_mgv1a015384mg [Mimulus guttatus] Length = 159 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFRKRMSTT GRA+I+RRR+KGRW LCTKTNP SGKRA Sbjct: 115 LARTHGFRKRMSTTRGRAVIQRRRAKGRWILCTKTNPISGKRA 157 >ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] gi|557093385|gb|ESQ33967.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] Length = 160 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 118 LARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 160 >ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] gi|482572095|gb|EOA36282.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] Length = 156 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 114 LARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 156 >ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana] gi|75311421|sp|Q9LP37.1|RK34_ARATH RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|9502428|gb|AAF88127.1|AC021043_20 Putative ribosomal protein L34 [Arabidopsis thaliana] gi|17380840|gb|AAL36232.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|20259639|gb|AAM14176.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|21536900|gb|AAM61232.1| plastid ribosomal protein L34 precursor, putative [Arabidopsis thaliana] gi|332192918|gb|AEE31039.1| 50S ribosomal protein L34 [Arabidopsis thaliana] Length = 157 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 115 LARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 157 >ref|XP_002890790.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] gi|297336632|gb|EFH67049.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] Length = 159 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 117 LARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 159 >sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|189096152|pdb|3BBO|4 Chain 4, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7578860|gb|AAF64157.1|AF238221_1 plastid ribosomal protein L34 precursor [Spinacia oleracea] Length = 152 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR RMSTTSGRAL+KRRR+KGR LCTKTNPSSGKRA Sbjct: 108 LARTHGFRLRMSTTSGRALLKRRRAKGRKILCTKTNPSSGKRA 150 >ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 150 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA++KRRR+KGR LCTKTNP+SGKRA Sbjct: 108 LARTHGFRRRMRTTSGRAMLKRRRAKGRKVLCTKTNPNSGKRA 150 >ref|XP_006346545.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565359499|ref|XP_006346546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 156 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFRKRMSTTSGRA I+RRR+KGRW LC K++P +GKRA Sbjct: 114 LARTHGFRKRMSTTSGRATIQRRRAKGRWDLCPKSSPRTGKRA 156 >ref|XP_004229053.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Solanum lycopersicum] Length = 156 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFRKRMSTTSGRA I+RRR+KGRW LC K++P +GKRA Sbjct: 114 LARTHGFRKRMSTTSGRATIQRRRAKGRWDLCPKSSPRTGKRA 156 >emb|CBI30669.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 71 LARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 113 >ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Vitis vinifera] Length = 148 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 106 LARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 148 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 106 LARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 148 >ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Citrus sinensis] Length = 161 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA++KRRR+KGRW LC K+ P+SGKRA Sbjct: 119 LARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 161 >ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|567914339|ref|XP_006449483.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552093|gb|ESR62722.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552094|gb|ESR62723.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] Length = 161 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA++KRRR+KGRW LC K+ P+SGKRA Sbjct: 119 LARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 161 >ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] gi|462407923|gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] Length = 209 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TT GRA++KRRR+KGR LCTKTNP+SGKRA Sbjct: 167 LARTHGFRRRMRTTGGRAMLKRRRAKGRKILCTKTNPNSGKRA 209 >ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] gi|449479241|ref|XP_004155546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] Length = 155 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TT+GRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 113 LARTHGFRRRMRTTNGRAVLKRRRAKGRKVLCTKSNPSSGKRA 155 >ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] gi|508780782|gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 131 LARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGKR+ Sbjct: 116 LARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGKRS 158 >ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] gi|550327876|gb|EEE98039.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] Length = 160 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 125 LARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGK Sbjct: 118 LARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 158 >ref|XP_003593758.1| 50S ribosomal protein L34 [Medicago truncatula] gi|355482806|gb|AES64009.1| 50S ribosomal protein L34 [Medicago truncatula] Length = 144 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/41 (78%), Positives = 39/41 (95%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 125 LARTHGFRKRMSTT+GRA++KRRR+KGR LCTK++P+SGK Sbjct: 104 LARTHGFRKRMSTTTGRAVLKRRRAKGRKVLCTKSHPNSGK 144 >ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] gi|223538249|gb|EEF39858.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] Length = 161 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +3 Query: 3 LARTHGFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 125 LARTHGFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGK Sbjct: 119 LARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 159