BLASTX nr result
ID: Mentha26_contig00005413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005413 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43351.1| hypothetical protein MIMGU_mgv1a015384mg [Mimulus... 70 4e-10 ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutr... 69 7e-10 ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Caps... 69 7e-10 ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana... 69 7e-10 ref|XP_002890790.1| ribosomal protein L34 family protein [Arabid... 69 7e-10 sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, ... 68 2e-09 ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloro... 66 6e-09 ref|XP_006346545.1| PREDICTED: 50S ribosomal protein L34, chloro... 65 1e-08 ref|XP_004229053.1| PREDICTED: 50S ribosomal protein L34, chloro... 65 1e-08 emb|CBI30669.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloro... 65 1e-08 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 65 1e-08 ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloro... 64 2e-08 ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citr... 64 2e-08 ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prun... 64 2e-08 ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloro... 64 2e-08 ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] ... 63 5e-08 ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Popu... 60 2e-07 ref|XP_003593758.1| 50S ribosomal protein L34 [Medicago truncatu... 60 2e-07 ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precu... 60 2e-07 >gb|EYU43351.1| hypothetical protein MIMGU_mgv1a015384mg [Mimulus guttatus] Length = 159 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFRKRMSTT GRA+I+RRR+KGRW LCTKTNP SGKRA Sbjct: 120 GFRKRMSTTRGRAVIQRRRAKGRWILCTKTNPISGKRA 157 >ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] gi|557093385|gb|ESQ33967.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] Length = 160 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 123 GFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 160 >ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] gi|482572095|gb|EOA36282.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] Length = 156 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 119 GFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 156 >ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana] gi|75311421|sp|Q9LP37.1|RK34_ARATH RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|9502428|gb|AAF88127.1|AC021043_20 Putative ribosomal protein L34 [Arabidopsis thaliana] gi|17380840|gb|AAL36232.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|20259639|gb|AAM14176.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|21536900|gb|AAM61232.1| plastid ribosomal protein L34 precursor, putative [Arabidopsis thaliana] gi|332192918|gb|AEE31039.1| 50S ribosomal protein L34 [Arabidopsis thaliana] Length = 157 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 120 GFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 157 >ref|XP_002890790.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] gi|297336632|gb|EFH67049.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] Length = 159 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA IKRRR+KGRW LC K+NPSSGKRA Sbjct: 122 GFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 159 >sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|189096152|pdb|3BBO|4 Chain 4, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7578860|gb|AAF64157.1|AF238221_1 plastid ribosomal protein L34 precursor [Spinacia oleracea] Length = 152 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR RMSTTSGRAL+KRRR+KGR LCTKTNPSSGKRA Sbjct: 113 GFRLRMSTTSGRALLKRRRAKGRKILCTKTNPSSGKRA 150 >ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 150 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA++KRRR+KGR LCTKTNP+SGKRA Sbjct: 113 GFRRRMRTTSGRAMLKRRRAKGRKVLCTKTNPNSGKRA 150 >ref|XP_006346545.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565359499|ref|XP_006346546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 156 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFRKRMSTTSGRA I+RRR+KGRW LC K++P +GKRA Sbjct: 119 GFRKRMSTTSGRATIQRRRAKGRWDLCPKSSPRTGKRA 156 >ref|XP_004229053.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Solanum lycopersicum] Length = 156 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFRKRMSTTSGRA I+RRR+KGRW LC K++P +GKRA Sbjct: 119 GFRKRMSTTSGRATIQRRRAKGRWDLCPKSSPRTGKRA 156 >emb|CBI30669.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 76 GFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 113 >ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Vitis vinifera] Length = 148 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 111 GFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 148 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 111 GFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKRA 148 >ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Citrus sinensis] Length = 161 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA++KRRR+KGRW LC K+ P+SGKRA Sbjct: 124 GFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 161 >ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|567914339|ref|XP_006449483.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552093|gb|ESR62722.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552094|gb|ESR62723.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] Length = 161 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA++KRRR+KGRW LC K+ P+SGKRA Sbjct: 124 GFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 161 >ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] gi|462407923|gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] Length = 209 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TT GRA++KRRR+KGR LCTKTNP+SGKRA Sbjct: 172 GFRRRMRTTGGRAMLKRRRAKGRKILCTKTNPNSGKRA 209 >ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] gi|449479241|ref|XP_004155546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] Length = 155 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TT+GRA++KRRR+KGR LCTK+NPSSGKRA Sbjct: 118 GFRRRMRTTNGRAVLKRRRAKGRKVLCTKSNPSSGKRA 155 >ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] gi|508780782|gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGKRA 116 GFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGKR+ Sbjct: 121 GFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGKRS 158 >ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] gi|550327876|gb|EEE98039.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] Length = 160 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 110 GFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGK Sbjct: 123 GFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 158 >ref|XP_003593758.1| 50S ribosomal protein L34 [Medicago truncatula] gi|355482806|gb|AES64009.1| 50S ribosomal protein L34 [Medicago truncatula] Length = 144 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 110 GFRKRMSTT+GRA++KRRR+KGR LCTK++P+SGK Sbjct: 109 GFRKRMSTTTGRAVLKRRRAKGRKVLCTKSHPNSGK 144 >ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] gi|223538249|gb|EEF39858.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] Length = 161 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 3 GFRKRMSTTSGRALIKRRRSKGRWKLCTKTNPSSGK 110 GFR+RM TTSGRA++KRRR+KGR LCTK+NP+SGK Sbjct: 124 GFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 159