BLASTX nr result
ID: Mentha26_contig00005330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005330 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39674.1| hypothetical protein MIMGU_mgv1a015683mg [Mimulus... 60 3e-07 gb|EYU37023.1| hypothetical protein MIMGU_mgv1a015651mg [Mimulus... 60 3e-07 gb|EYU36125.1| hypothetical protein MIMGU_mgv1a015485mg [Mimulus... 60 3e-07 gb|EYU32448.1| hypothetical protein MIMGU_mgv1a019785mg [Mimulus... 60 3e-07 gb|AHN10448.1| HTB2-GUS [Binary vector pFGUS3] 60 3e-07 gb|EXC35052.1| putative histone H2B.1 [Morus notabilis] 60 3e-07 gb|EXC24908.1| Histone H2B.3 [Morus notabilis] 60 3e-07 gb|EXB75919.1| Histone H2B [Morus notabilis] 60 3e-07 gb|EXB69115.1| putative histone H2B.1 [Morus notabilis] gi|58790... 60 3e-07 gb|EXB52245.1| putative histone H2B.1 [Morus notabilis] 60 3e-07 sp|Q43216.3|H2B5_WHEAT RecName: Full=Histone H2B.5; AltName: Ful... 60 3e-07 ref|NP_187559.1| histone H2B [Arabidopsis thaliana] gi|75204313... 60 3e-07 sp|Q9LGH8.1|H2B8_ORYSJ RecName: Full=Histone H2B.8 gi|152032520|... 60 3e-07 sp|P93354.3|H2B_TOBAC RecName: Full=Histone H2B gi|1848210|emb|C... 60 3e-07 sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B gi|2558962|gb|AA... 60 3e-07 ref|NP_197679.1| histone H2B [Arabidopsis thaliana] gi|75170197... 60 3e-07 ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isofo... 60 3e-07 ref|XP_003538007.2| PREDICTED: probable histone H2B.1-like isofo... 60 3e-07 ref|XP_006488268.1| PREDICTED: probable histone H2B.1-like [Citr... 60 3e-07 ref|XP_006364445.1| PREDICTED: histone H2B-like [Solanum tuberosum] 60 3e-07 >gb|EYU39674.1| hypothetical protein MIMGU_mgv1a015683mg [Mimulus guttatus] gi|604335787|gb|EYU39675.1| hypothetical protein MIMGU_mgv1a015697mg [Mimulus guttatus] Length = 149 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 120 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 149 >gb|EYU37023.1| hypothetical protein MIMGU_mgv1a015651mg [Mimulus guttatus] Length = 150 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 121 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 150 >gb|EYU36125.1| hypothetical protein MIMGU_mgv1a015485mg [Mimulus guttatus] Length = 156 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 127 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 156 >gb|EYU32448.1| hypothetical protein MIMGU_mgv1a019785mg [Mimulus guttatus] Length = 138 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 109 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 138 >gb|AHN10448.1| HTB2-GUS [Binary vector pFGUS3] Length = 762 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 116 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 >gb|EXC35052.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 119 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 >gb|EXC24908.1| Histone H2B.3 [Morus notabilis] Length = 146 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 146 >gb|EXB75919.1| Histone H2B [Morus notabilis] Length = 137 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 108 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 137 >gb|EXB69115.1| putative histone H2B.1 [Morus notabilis] gi|587908853|gb|EXB96786.1| putative histone H2B.1 [Morus notabilis] gi|587945411|gb|EXC31818.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 119 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 >gb|EXB52245.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 119 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 >sp|Q43216.3|H2B5_WHEAT RecName: Full=Histone H2B.5; AltName: Full=wcH2B-6 gi|531056|dbj|BAA07156.1| protein H2B-6 [Triticum aestivum] Length = 136 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 136 >ref|NP_187559.1| histone H2B [Arabidopsis thaliana] gi|75204313|sp|Q9SF55.3|H2B5_ARATH RecName: Full=Histone H2B.5; AltName: Full=HTB7 gi|6682228|gb|AAF23280.1|AC016661_5 putative histone H2B [Arabidopsis thaliana] gi|34365619|gb|AAQ65121.1| At3g09480 [Arabidopsis thaliana] gi|51969742|dbj|BAD43563.1| putative histone H2B [Arabidopsis thaliana] gi|51970148|dbj|BAD43766.1| putative histone H2B [Arabidopsis thaliana] gi|51971867|dbj|BAD44598.1| putative histone H2B [Arabidopsis thaliana] gi|332641251|gb|AEE74772.1| histone H2B [Arabidopsis thaliana] Length = 126 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 97 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 126 >sp|Q9LGH8.1|H2B8_ORYSJ RecName: Full=Histone H2B.8 gi|152032520|sp|A2WKS5.1|H2B8_ORYSI RecName: Full=Histone H2B.8 gi|9663987|dbj|BAB03628.1| putative histone H2B [Oryza sativa Japonica Group] gi|13872944|dbj|BAB44049.1| putative histone H2B [Oryza sativa Japonica Group] gi|125524457|gb|EAY72571.1| hypothetical protein OsI_00437 [Oryza sativa Indica Group] gi|125569062|gb|EAZ10577.1| hypothetical protein OsJ_00409 [Oryza sativa Japonica Group] Length = 153 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 124 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 153 >sp|P93354.3|H2B_TOBAC RecName: Full=Histone H2B gi|1848210|emb|CAA72091.1| histone H2B1 [Nicotiana tabacum] Length = 146 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 146 >sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B gi|2558962|gb|AAB97163.1| histone H2B1 [Gossypium hirsutum] Length = 147 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 118 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 >ref|NP_197679.1| histone H2B [Arabidopsis thaliana] gi|75170197|sp|Q9FFC0.3|H2B10_ARATH RecName: Full=Histone H2B.10; AltName: Full=HTB2 gi|10177235|dbj|BAB10609.1| histone H2B like protein [Arabidopsis thaliana] gi|98960883|gb|ABF58925.1| At5g22880 [Arabidopsis thaliana] gi|332005710|gb|AED93093.1| histone H2B [Arabidopsis thaliana] Length = 145 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 116 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 >ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] Length = 292 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 263 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 292 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFT 262 QTAVRLVLPGELAKHAVSEGTKAVTKFT Sbjct: 120 QTAVRLVLPGELAKHAVSEGTKAVTKFT 147 >ref|XP_003538007.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] Length = 290 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 261 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 290 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFT 262 QTAVRLVLPGELAKHAVSEGTKAVTKFT Sbjct: 119 QTAVRLVLPGELAKHAVSEGTKAVTKFT 146 >ref|XP_006488268.1| PREDICTED: probable histone H2B.1-like [Citrus sinensis] Length = 146 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 146 >ref|XP_006364445.1| PREDICTED: histone H2B-like [Solanum tuberosum] Length = 141 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 345 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 256 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 QTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141