BLASTX nr result
ID: Mentha26_contig00005311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005311 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29698.1| hypothetical protein MIMGU_mgv1a014988mg [Mimulus... 61 1e-07 gb|EPS58600.1| hypothetical protein M569_16210 [Genlisea aurea] 55 8e-06 >gb|EYU29698.1| hypothetical protein MIMGU_mgv1a014988mg [Mimulus guttatus] Length = 171 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 196 RSDDSNLICRAEKEYKFPDPIPEFADSETEKF 291 + DSN ICRAEKEYKFPDPIPEFADSET KF Sbjct: 51 KKKDSNFICRAEKEYKFPDPIPEFADSETVKF 82 >gb|EPS58600.1| hypothetical protein M569_16210 [Genlisea aurea] Length = 175 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 208 SNLICRAEKEYKFPDPIPEFADSETEKF 291 S+ CRAEKEYKFPDPIPEFAD+ETEKF Sbjct: 58 SSFRCRAEKEYKFPDPIPEFADAETEKF 85