BLASTX nr result
ID: Mentha26_contig00005109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005109 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45365.1| hypothetical protein MIMGU_mgv1a011735mg [Mimulus... 63 4e-08 >gb|EYU45365.1| hypothetical protein MIMGU_mgv1a011735mg [Mimulus guttatus] Length = 272 Score = 63.2 bits (152), Expect = 4e-08 Identities = 37/57 (64%), Positives = 47/57 (82%), Gaps = 3/57 (5%) Frame = -2 Query: 163 PQYLQKSSFQGVSVQEAKRAVFNSLVLEGI---SSVRSVRKGGLEVSARTAGTAKNI 2 PQ+ QK+SFQG+S+Q+AKR VFNSLV E I S+V+SVR+ G E++AR AGTAKNI Sbjct: 33 PQF-QKTSFQGLSIQDAKRVVFNSLVSERIIINSNVKSVRERGFEITAR-AGTAKNI 87