BLASTX nr result
ID: Mentha26_contig00005053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005053 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS57459.1| hypothetical protein M569_17358 [Genlisea aurea] 57 6e-09 >gb|EPS57459.1| hypothetical protein M569_17358 [Genlisea aurea] Length = 182 Score = 56.6 bits (135), Expect(2) = 6e-09 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = +2 Query: 209 DRRFSALKADDILVGGGVYLLIPVSRVKGKVSDPEMAAIESLCGSR 346 +RR A++ADD+L GGG Y+LIP+ RV +V++ EMA ++S+ GSR Sbjct: 56 NRRICAMRADDVLSGGGTYVLIPIHRVNRRVTEAEMAILDSIAGSR 101 Score = 29.3 bits (64), Expect(2) = 6e-09 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 88 MGNISSCFSAQSN-TAKLIHLHRETVRI 168 MGN SCF ++S+ AKLI LHR R+ Sbjct: 1 MGNSISCFDSKSDKAAKLIDLHRNLQRL 28