BLASTX nr result
ID: Mentha26_contig00005035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00005035 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Mimulus... 86 4e-15 ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing st... 85 1e-14 ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutr... 84 3e-14 ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Caps... 84 3e-14 ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana] gi|753350... 84 3e-14 ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arab... 84 3e-14 ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-co... 83 4e-14 gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238... 83 4e-14 gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] 83 4e-14 ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-co... 83 4e-14 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] 83 4e-14 ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-co... 83 5e-14 ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing st... 83 5e-14 ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-co... 82 8e-14 gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] 82 8e-14 ref|XP_002314027.1| zinc finger family protein [Populus trichoca... 82 8e-14 gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Mimulus... 82 1e-13 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-... 82 1e-13 ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phas... 82 1e-13 ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-co... 82 1e-13 >gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Mimulus guttatus] Length = 179 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFCADHRYSDRHDCSYDYKTAGREAIARENP Sbjct: 133 RCRCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 169 >ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5, putative [Theobroma cacao] gi|508704822|gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5, putative [Theobroma cacao] Length = 192 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFCA+HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 146 RCRCGELFCAEHRYSDRHDCSYDYKTAGREAIARENP 182 >ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum] gi|557108459|gb|ESQ48766.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum] Length = 158 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CG+LFCA+HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 112 RCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENP 148 >ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella] gi|482567416|gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella] Length = 163 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC++HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 117 RCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP 153 >ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana] gi|75335009|sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated protein 5; Short=AtSAP5 gi|12321951|gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana] gi|9294357|dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana] gi|21536983|gb|AAM61324.1| unknown [Arabidopsis thaliana] gi|32815927|gb|AAP88348.1| At3g12630 [Arabidopsis thaliana] gi|110736612|dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana] gi|332641705|gb|AEE75226.1| E3 ligase SAP5 [Arabidopsis thaliana] Length = 160 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC++HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 114 RCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP 150 >ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. lyrata] gi|297328623|gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. lyrata] Length = 160 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC++HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 114 RCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP 150 >ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 2 [Solanum lycopersicum] Length = 159 Score = 83.2 bits (204), Expect = 4e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 113 RCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 149 >gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238816903|gb|ACR56826.1| At3g12630-like protein [Solanum quitoense] Length = 150 Score = 83.2 bits (204), Expect = 4e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 110 RCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 146 >gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] Length = 87 Score = 83.2 bits (204), Expect = 4e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 41 RCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 77 >ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 1 [Solanum lycopersicum] gi|88866527|gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] Length = 188 Score = 83.2 bits (204), Expect = 4e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 142 RCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 178 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] Length = 88 Score = 83.2 bits (204), Expect = 4e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 42 RCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 78 >ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Glycine max] Length = 161 Score = 82.8 bits (203), Expect = 5e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFCA+HRYSDRHDCSYDYK AGREAIARENP Sbjct: 115 RCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP 151 >ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] gi|300510880|gb|ADK25058.1| AN1-like transcription factor [Glycine max] Length = 164 Score = 82.8 bits (203), Expect = 5e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFCA+HRYSDRHDCSYDYK AGREAIARENP Sbjct: 118 RCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP 154 >ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Solanum tuberosum] Length = 187 Score = 82.0 bits (201), Expect = 8e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDC+YDYKTAGREAIARENP Sbjct: 141 RCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP 177 >gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] Length = 147 Score = 82.0 bits (201), Expect = 8e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDC+YDYKTAGREAIARENP Sbjct: 107 RCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP 143 >ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa] gi|222850435|gb|EEE87982.1| zinc finger family protein [Populus trichocarpa] Length = 179 Score = 82.0 bits (201), Expect = 8e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFC +HRYSDRHDCSYDYKTAGREAIARENP Sbjct: 133 RCRCGELFCWEHRYSDRHDCSYDYKTAGREAIARENP 169 >gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Mimulus guttatus] Length = 178 Score = 81.6 bits (200), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CG+LFCADHRYSDRHDCSYDYK+AGREAI RENP Sbjct: 132 RCRCGDLFCADHRYSDRHDCSYDYKSAGREAIERENP 168 >gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Morus notabilis] Length = 172 Score = 81.6 bits (200), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CGELFCA+HRYSDRHDCSYDYK+ GREAIARENP Sbjct: 126 RCRCGELFCAEHRYSDRHDCSYDYKSVGREAIARENP 162 >ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris] gi|561022312|gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris] Length = 301 Score = 81.6 bits (200), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CG+LFCA+HRYSDRHDCSYDYK AGREAIARENP Sbjct: 255 RCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP 291 >ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] Length = 137 Score = 81.6 bits (200), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 RCKCGELFCADHRYSDRHDCSYDYKTAGREAIARENP 113 RC+CG+LFCA+HRYSDRHDCSYDYK AGREAIARENP Sbjct: 91 RCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP 127