BLASTX nr result
ID: Mentha26_contig00004871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00004871 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46488.1| hypothetical protein MIMGU_mgv1a008523mg [Mimulus... 62 1e-07 >gb|EYU46488.1| hypothetical protein MIMGU_mgv1a008523mg [Mimulus guttatus] Length = 371 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -1 Query: 424 WEELLKARSDEEKITLRTKVAVNGNSSRVQLTSLQKVVSELIPKLECAERKTVEAC 257 W ELLK+ S ++ITL K+AVNGN + ++ +Q VVSEL+P+LECA+ V AC Sbjct: 316 WVELLKSHSGAQEITLLAKLAVNGNHNWLRRAPMQNVVSELLPRLECAQTNQVGAC 371