BLASTX nr result
ID: Mentha26_contig00004837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00004837 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19069.1| hypothetical protein MIMGU_mgv1a001971mg [Mimulus... 61 1e-07 >gb|EYU19069.1| hypothetical protein MIMGU_mgv1a001971mg [Mimulus guttatus] Length = 732 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/94 (34%), Positives = 57/94 (60%), Gaps = 4/94 (4%) Frame = +3 Query: 48 NNIPRRKKVFKKSLREEEKSSDDEVTDVREDSRKGRI---GALYKKDSRKGDFRETEM-V 215 +N R++++ KK++REEE++ D T R +SRKG + GA ++ SRKGDFR+ + + Sbjct: 107 SNTSRKQRIVKKNVREEEENGADVATSARRESRKGVVSNNGAFVREGSRKGDFRDDGVSL 166 Query: 216 DKMQNRDLKMRSRKISDGXXXXXXXLLMDRAAFK 317 +K + +D +++ + + M+RAAFK Sbjct: 167 EKFKKQDKNLKAYTVKKNVSRESEFMDMERAAFK 200