BLASTX nr result
ID: Mentha26_contig00004709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00004709 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19526.1| hypothetical protein MIMGU_mgv1a001368mg [Mimulus... 79 7e-13 >gb|EYU19526.1| hypothetical protein MIMGU_mgv1a001368mg [Mimulus guttatus] gi|604299684|gb|EYU19527.1| hypothetical protein MIMGU_mgv1a001368mg [Mimulus guttatus] Length = 833 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LIHSQFQDPVSNGNQLKQVMDESQHPNSSSFMHYNHRYRAAGV 129 LI +QFQDP+SNG QLK VMD+ QHP+SSSFMHYNHRYRAAGV Sbjct: 791 LIRNQFQDPMSNGTQLKPVMDDDQHPHSSSFMHYNHRYRAAGV 833