BLASTX nr result
ID: Mentha26_contig00004546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00004546 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002871578.1| elongation factor family protein [Arabidopsi... 69 7e-10 ref|XP_004513771.1| PREDICTED: GTP-binding protein TypA/BipA hom... 67 2e-09 gb|AFK47094.1| unknown [Lotus japonicus] 67 2e-09 gb|ABX90064.1| tyrosine phosphorylated protein A [Suaeda salsa] 67 2e-09 gb|EPS64041.1| hypothetical protein M569_10740, partial [Genlise... 67 3e-09 gb|EYU18751.1| hypothetical protein MIMGU_mgv1a002359mg [Mimulus... 67 3e-09 ref|XP_006399860.1| hypothetical protein EUTSA_v10012883mg [Eutr... 67 3e-09 gb|EXB52899.1| GTP-binding protein TypA/BipA-like protein [Morus... 66 4e-09 ref|XP_003572614.1| PREDICTED: GTP-binding protein TypA/BipA hom... 66 4e-09 ref|XP_002308959.2| hypothetical protein POPTR_0006s05160g [Popu... 66 6e-09 ref|XP_006381016.1| hypothetical protein POPTR_0006s05150g [Popu... 66 6e-09 gb|AAL24425.1| GTP-binding protein typA (tyrosine phosphorylated... 66 6e-09 ref|NP_568289.3| putative TypA-like translation elongation facto... 66 6e-09 dbj|BAB08691.1| GTP-binding protein typA (tyrosine phosphorylate... 66 6e-09 ref|NP_851035.1| putative TypA-like translation elongation facto... 66 6e-09 ref|XP_006421423.1| hypothetical protein CICLE_v10004468mg [Citr... 65 8e-09 ref|XP_006489928.1| PREDICTED: translation factor GUF1 homolog, ... 65 1e-08 ref|XP_004165899.1| PREDICTED: GTP-binding protein TypA/BipA hom... 65 1e-08 ref|XP_004136615.1| PREDICTED: GTP-binding protein TypA/BipA hom... 65 1e-08 gb|ABR14707.1| GTP binding tyrosine phosphorylated protein A [Cu... 65 1e-08 >ref|XP_002871578.1| elongation factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297317415|gb|EFH47837.1| elongation factor family protein [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYI+EDELVEVTPSSIRMCKNPKM KKGR Sbjct: 642 DDCIEYIEEDELVEVTPSSIRMCKNPKMAKKGR 674 >ref|XP_004513771.1| PREDICTED: GTP-binding protein TypA/BipA homolog isoform X1 [Cicer arietinum] gi|502166046|ref|XP_004513772.1| PREDICTED: GTP-binding protein TypA/BipA homolog isoform X2 [Cicer arietinum] Length = 672 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTP SIRMCKNPK+ KKGR Sbjct: 640 DDCIEYIQEDELVEVTPQSIRMCKNPKLAKKGR 672 >gb|AFK47094.1| unknown [Lotus japonicus] Length = 186 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTP SIRMCKNPK+ KKGR Sbjct: 154 DDCIEYIQEDELVEVTPQSIRMCKNPKLAKKGR 186 >gb|ABX90064.1| tyrosine phosphorylated protein A [Suaeda salsa] Length = 683 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTP +IRMCKNPKM KKGR Sbjct: 651 DDCIEYIQEDELVEVTPQNIRMCKNPKMTKKGR 683 >gb|EPS64041.1| hypothetical protein M569_10740, partial [Genlisea aurea] Length = 603 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTPSSIRMCKNPKM KK R Sbjct: 571 DDCIEYIQEDELVEVTPSSIRMCKNPKMAKKTR 603 >gb|EYU18751.1| hypothetical protein MIMGU_mgv1a002359mg [Mimulus guttatus] Length = 684 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTP+SIRMCKNPKM+KK R Sbjct: 650 DDCIEYIQEDELVEVTPASIRMCKNPKMLKKFR 682 >ref|XP_006399860.1| hypothetical protein EUTSA_v10012883mg [Eutrema salsugineum] gi|557100950|gb|ESQ41313.1| hypothetical protein EUTSA_v10012883mg [Eutrema salsugineum] Length = 673 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYI+EDELVEVTP SIRMCKNPKM KKGR Sbjct: 641 DDCIEYIEEDELVEVTPLSIRMCKNPKMAKKGR 673 >gb|EXB52899.1| GTP-binding protein TypA/BipA-like protein [Morus notabilis] Length = 1012 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR*KLFV 116 DDCIEYIQEDELVEVTP SIRMCKNPKM KK R K + Sbjct: 920 DDCIEYIQEDELVEVTPLSIRMCKNPKMAKKSRPKCHI 957 >ref|XP_003572614.1| PREDICTED: GTP-binding protein TypA/BipA homolog [Brachypodium distachyon] Length = 677 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTP+SIRMCKNPK+ KKG+ Sbjct: 644 DDCIEYIQEDELVEVTPASIRMCKNPKISKKGK 676 >ref|XP_002308959.2| hypothetical protein POPTR_0006s05160g [Populus trichocarpa] gi|550335502|gb|EEE92482.2| hypothetical protein POPTR_0006s05160g [Populus trichocarpa] Length = 679 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTPSSIRMCKNPK+ KK R Sbjct: 647 DDCIEYIQEDELVEVTPSSIRMCKNPKLAKKTR 679 >ref|XP_006381016.1| hypothetical protein POPTR_0006s05150g [Populus trichocarpa] gi|550335501|gb|ERP58813.1| hypothetical protein POPTR_0006s05150g [Populus trichocarpa] Length = 173 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTPSSIRMCKNPK+ KK R Sbjct: 141 DDCIEYIQEDELVEVTPSSIRMCKNPKLAKKTR 173 >gb|AAL24425.1| GTP-binding protein typA (tyrosine phosphorylated protein A) [Arabidopsis thaliana] gi|24899717|gb|AAN65073.1| GTP-binding protein typA (tyrosine phosphorylated protein A) [Arabidopsis thaliana] Length = 392 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYI+EDELVEVTPSSIRMCKN KM KKGR Sbjct: 359 DDCIEYIEEDELVEVTPSSIRMCKNQKMAKKGR 391 >ref|NP_568289.3| putative TypA-like translation elongation factor SVR3 [Arabidopsis thaliana] gi|332004540|gb|AED91923.1| putative TypA-like translation elongation factor SVR3 [Arabidopsis thaliana] Length = 676 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYI+EDELVEVTPSSIRMCKN KM KKGR Sbjct: 643 DDCIEYIEEDELVEVTPSSIRMCKNQKMAKKGR 675 >dbj|BAB08691.1| GTP-binding protein typA (tyrosine phosphorylated protein A) [Arabidopsis thaliana] Length = 609 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYI+EDELVEVTPSSIRMCKN KM KKGR Sbjct: 576 DDCIEYIEEDELVEVTPSSIRMCKNQKMAKKGR 608 >ref|NP_851035.1| putative TypA-like translation elongation factor SVR3 [Arabidopsis thaliana] gi|332004539|gb|AED91922.1| putative TypA-like translation elongation factor SVR3 [Arabidopsis thaliana] Length = 675 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYI+EDELVEVTPSSIRMCKN KM KKGR Sbjct: 642 DDCIEYIEEDELVEVTPSSIRMCKNQKMAKKGR 674 >ref|XP_006421423.1| hypothetical protein CICLE_v10004468mg [Citrus clementina] gi|567857482|ref|XP_006421424.1| hypothetical protein CICLE_v10004468mg [Citrus clementina] gi|557523296|gb|ESR34663.1| hypothetical protein CICLE_v10004468mg [Citrus clementina] gi|557523297|gb|ESR34664.1| hypothetical protein CICLE_v10004468mg [Citrus clementina] Length = 681 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTP SIRMCKNPK +K+GR Sbjct: 649 DDCIEYIQEDELVEVTPLSIRMCKNPKFVKRGR 681 >ref|XP_006489928.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like [Citrus sinensis] Length = 681 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTP SIRMCKNPK K+GR Sbjct: 649 DDCIEYIQEDELVEVTPLSIRMCKNPKFAKRGR 681 >ref|XP_004165899.1| PREDICTED: GTP-binding protein TypA/BipA homolog [Cucumis sativus] Length = 680 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTPSSIRMCKN KM KK R Sbjct: 648 DDCIEYIQEDELVEVTPSSIRMCKNAKMAKKAR 680 >ref|XP_004136615.1| PREDICTED: GTP-binding protein TypA/BipA homolog [Cucumis sativus] Length = 680 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTPSSIRMCKN KM KK R Sbjct: 648 DDCIEYIQEDELVEVTPSSIRMCKNAKMAKKAR 680 >gb|ABR14707.1| GTP binding tyrosine phosphorylated protein A [Cucumis sativus] Length = 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +3 Query: 3 DDCIEYIQEDELVEVTPSSIRMCKNPKMMKKGR 101 DDCIEYIQEDELVEVTPSSIRMCKN KM KK R Sbjct: 28 DDCIEYIQEDELVEVTPSSIRMCKNAKMAKKAR 60