BLASTX nr result
ID: Mentha26_contig00004488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00004488 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19968.1| hypothetical protein MIMGU_mgv1a007272mg [Mimulus... 70 3e-10 >gb|EYU19968.1| hypothetical protein MIMGU_mgv1a007272mg [Mimulus guttatus] Length = 413 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = -3 Query: 133 VSVPNKPHLGSNLLLIGDAKFTKNSSYIRLTNPKISSPSAGLI 5 VS+PNKP+ GSNL+LIGDA+FT NSS I+LTNPKISSPS+G + Sbjct: 89 VSLPNKPYFGSNLVLIGDARFTNNSSCIQLTNPKISSPSSGFL 131