BLASTX nr result
ID: Mentha26_contig00004269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00004269 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABQ66373.1| THIC, partial [Ocimum basilicum] 59 5e-07 >gb|ABQ66373.1| THIC, partial [Ocimum basilicum] Length = 70 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 376 AATKTVSGEQHGEVGGEIYLPEEYVKAKAI 287 AA KTVSGEQHGEVGGEIYLPEEYVK+KA+ Sbjct: 41 AAKKTVSGEQHGEVGGEIYLPEEYVKSKAV 70