BLASTX nr result
ID: Mentha26_contig00003973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00003973 (680 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007042479.1| Cystathionine beta-synthase family protein [... 57 7e-06 ref|XP_006339869.1| PREDICTED: CBS domain-containing protein CBS... 56 9e-06 ref|XP_004231863.1| PREDICTED: CBS domain-containing protein CBS... 56 9e-06 ref|XP_004231862.1| PREDICTED: CBS domain-containing protein CBS... 56 9e-06 >ref|XP_007042479.1| Cystathionine beta-synthase family protein [Theobroma cacao] gi|508706414|gb|EOX98310.1| Cystathionine beta-synthase family protein [Theobroma cacao] Length = 230 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 678 LPVVDGDGKLVGILTRGNIVRAALQIKATQEMES 577 LPVVDGDGKLVGI+TRGN+VRAALQIK E S Sbjct: 197 LPVVDGDGKLVGIITRGNVVRAALQIKRASERSS 230 >ref|XP_006339869.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Solanum tuberosum] Length = 232 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 678 LPVVDGDGKLVGILTRGNIVRAALQIKATQEME 580 LPVVDG GKLVGI+TRGN+VRAALQIK EME Sbjct: 199 LPVVDGKGKLVGIITRGNVVRAALQIKRATEME 231 >ref|XP_004231863.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 234 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 678 LPVVDGDGKLVGILTRGNIVRAALQIKATQEME 580 LPVVDG GKLVGI+TRGN+VRAALQIK EME Sbjct: 201 LPVVDGKGKLVGIITRGNVVRAALQIKRATEME 233 >ref|XP_004231862.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform 1 [Solanum lycopersicum] Length = 251 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 678 LPVVDGDGKLVGILTRGNIVRAALQIKATQEME 580 LPVVDG GKLVGI+TRGN+VRAALQIK EME Sbjct: 218 LPVVDGKGKLVGIITRGNVVRAALQIKRATEME 250