BLASTX nr result
ID: Mentha26_contig00003427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00003427 (802 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499522.1| PREDICTED: enzymatic polyprotein-like [Cicer... 42 4e-06 >ref|XP_004499522.1| PREDICTED: enzymatic polyprotein-like [Cicer arietinum] Length = 1006 Score = 42.4 bits (98), Expect(3) = 4e-06 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = -2 Query: 681 LPMVRGGNLESWISRFEQYFYLRGILEASKLDVALIAMEPNALYWFQWKRAFQQ*GSRGI 502 LP G + +WI+R E YF ++G LE K+ +A ++ME ++WF R + Sbjct: 125 LPSFDGDDHVAWITRAETYFEVQGTLEEVKVRLAKLSMEGATIHWFNLLRETKD------ 178 Query: 501 NLSWS 487 NL+W+ Sbjct: 179 NLNWA 183 Score = 29.3 bits (64), Expect(3) = 4e-06 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -3 Query: 416 GLRADIRLKIRSCDARTLSETIHLAKKIEHEVEG 315 GL+ IRLK+R+ + +T + + +A+ +E E+ G Sbjct: 243 GLKNHIRLKVRTLNPQTRLQAMKIARDVETELHG 276 Score = 25.0 bits (53), Expect(3) = 4e-06 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 514 LTWNQFKLELLKMFGSNPLANPIETLVQTKQT 419 L W + K L++ +G NP E + +QT Sbjct: 180 LNWAKLKRALIERYGGRQSDNPFEEMKDLQQT 211