BLASTX nr result
ID: Mentha26_contig00003394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00003394 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002864846.1| EMB2746 [Arabidopsis lyrata subsp. lyrata] g... 59 9e-07 ref|XP_006279731.1| hypothetical protein CARUB_v10027519mg [Caps... 57 2e-06 >ref|XP_002864846.1| EMB2746 [Arabidopsis lyrata subsp. lyrata] gi|297310681|gb|EFH41105.1| EMB2746 [Arabidopsis lyrata subsp. lyrata] Length = 927 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 323 LVQKYEECKRDEKSQPSWPYFEDLNKILSSLETS 222 L+QKYEECK DE+S+ SWP+FED+N ILS L+TS Sbjct: 891 LIQKYEECKADERSKTSWPHFEDMNNILSELDTS 924 >ref|XP_006279731.1| hypothetical protein CARUB_v10027519mg [Capsella rubella] gi|482548435|gb|EOA12629.1| hypothetical protein CARUB_v10027519mg [Capsella rubella] Length = 908 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 323 LVQKYEECKRDEKSQPSWPYFEDLNKILSSLET 225 LVQKYEECK DE+S+ SWP+FED+N ILS L+T Sbjct: 873 LVQKYEECKADERSKTSWPHFEDMNNILSELDT 905