BLASTX nr result
ID: Mentha26_contig00002708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00002708 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18012.1| hypothetical protein MIMGU_mgv1a002702mg [Mimulus... 79 8e-13 >gb|EYU18012.1| hypothetical protein MIMGU_mgv1a002702mg [Mimulus guttatus] Length = 645 Score = 78.6 bits (192), Expect = 8e-13 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 6/95 (6%) Frame = -3 Query: 419 YRSEDSAFQLPVL-----HKPGEKFPPFVEDTFPNEADGTQFQSPLKTLSPDLPGYGAHS 255 YR E+S F LPVL + P FP FV++ F SPL +LSPDLPGY + Sbjct: 561 YRQEESGFHLPVLPAAETNIPQGGFPQFVKE----------FPSPLNSLSPDLPGYSPFN 610 Query: 254 LSFDGTSSLDTGDFDFFE-SLDGSDVGMLMEYFAS 153 L FDGTS+LDT DFDF + ++D ++ LM+YFAS Sbjct: 611 LQFDGTSALDTDDFDFDDNAVDEANFDELMKYFAS 645