BLASTX nr result
ID: Mentha26_contig00002351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00002351 (455 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACI31202.1| TRX [Salvia miltiorrhiza] 89 8e-16 gb|AGW24487.1| thioredoxin H-type 1, partial [Avicennia marina v... 87 3e-15 ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer ... 86 4e-15 gb|EYU32886.1| hypothetical protein MIMGU_mgv1a015367mg [Mimulus... 86 7e-15 ref|XP_007160713.1| hypothetical protein PHAVU_001G010800g [Phas... 86 7e-15 gb|AAZ32865.1| thioredoxin h [Medicago sativa] 86 7e-15 gb|AAZ98842.1| thioredoxin h1 [Medicago truncatula] 86 7e-15 emb|CAC42084.1| thioredoxin h [Pisum sativum] 86 7e-15 gb|EXC25027.1| Thioredoxin H-type 1 [Morus notabilis] 85 9e-15 ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanu... 85 9e-15 sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Shor... 85 9e-15 gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN... 85 9e-15 gb|AFK40280.1| unknown [Medicago truncatula] 85 1e-14 gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthami... 85 1e-14 ref|XP_003589341.1| Thioredoxin H-type [Medicago truncatula] gi|... 85 1e-14 gb|AAQ23134.1| thioredoxin H1 [Ipomoea batatas] 84 2e-14 ref|XP_007223789.1| hypothetical protein PRUPE_ppa013161mg [Prun... 84 2e-14 ref|XP_004500971.1| PREDICTED: thioredoxin H-type-like [Cicer ar... 84 2e-14 ref|XP_004291829.1| PREDICTED: thioredoxin H-type-like [Fragaria... 84 2e-14 emb|CAH59450.1| thioredoxin 1 [Plantago major] 84 2e-14 >gb|ACI31202.1| TRX [Salvia miltiorrhiza] Length = 122 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFIAPILAEIAKKTP VIFLKVDVDELKTV Sbjct: 32 VVVDFTASWCGPCRFIAPILAEIAKKTPHVIFLKVDVDELKTV 74 >gb|AGW24487.1| thioredoxin H-type 1, partial [Avicennia marina var. marina] Length = 70 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFIAPILAEIAKK+P V+FLKVDVDELKTV Sbjct: 1 VVVDFTASWCGPCRFIAPILAEIAKKSPHVVFLKVDVDELKTV 43 >ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer arietinum] Length = 120 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 +VVDFTASWCGPCRFIAPILAEIAK TP VIFLKVDVDELKTV Sbjct: 31 IVVDFTASWCGPCRFIAPILAEIAKNTPHVIFLKVDVDELKTV 73 >gb|EYU32886.1| hypothetical protein MIMGU_mgv1a015367mg [Mimulus guttatus] Length = 160 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFIAPILAEIAKKTP IFLKVDVDELK+V Sbjct: 74 VVVDFTASWCGPCRFIAPILAEIAKKTPHAIFLKVDVDELKSV 116 >ref|XP_007160713.1| hypothetical protein PHAVU_001G010800g [Phaseolus vulgaris] gi|561034177|gb|ESW32707.1| hypothetical protein PHAVU_001G010800g [Phaseolus vulgaris] Length = 118 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFIAPILAEIAKKTPE IFLKVDV+EL TV Sbjct: 30 VVVDFTASWCGPCRFIAPILAEIAKKTPEAIFLKVDVEELSTV 72 >gb|AAZ32865.1| thioredoxin h [Medicago sativa] Length = 117 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -2 Query: 145 GSCDQVVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 GS +VVDFTASWCGPCRFIAPILAEIAKK P V FLKVDVDELKTV Sbjct: 26 GSKKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDVDELKTV 73 >gb|AAZ98842.1| thioredoxin h1 [Medicago truncatula] Length = 117 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -2 Query: 145 GSCDQVVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 GS +VVDFTASWCGPCRFIAPILAEIAKK P V FLKVDVDELKTV Sbjct: 26 GSKKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDVDELKTV 73 >emb|CAC42084.1| thioredoxin h [Pisum sativum] Length = 118 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 +VVDFTASWCGPCRFIAPILAEIAKKTP+VIFLKVD+DEL++V Sbjct: 30 IVVDFTASWCGPCRFIAPILAEIAKKTPQVIFLKVDIDELESV 72 >gb|EXC25027.1| Thioredoxin H-type 1 [Morus notabilis] Length = 174 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCR IAPILAE+AKKTPEVIFLKVDVDELK V Sbjct: 89 VVVDFTASWCGPCRLIAPILAELAKKTPEVIFLKVDVDELKPV 131 >ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanum tuberosum] Length = 123 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFI+PILAEIAKKTP VIFLKVDVDELK V Sbjct: 33 VVVDFTASWCGPCRFISPILAEIAKKTPHVIFLKVDVDELKKV 75 >sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFIAPILA+IAKK P VIFLKVDVDELKTV Sbjct: 37 VVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTV 79 >gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN42904.1| thioredoxin H-type [Capsicum annuum] Length = 124 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFIAPILA+IAKK P VIFLKVDVDELKTV Sbjct: 34 VVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTV 76 >gb|AFK40280.1| unknown [Medicago truncatula] Length = 96 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 +VVDFTASWCGPCRFIAPILAEIAKK PEVIFLKVD+DE+K+V Sbjct: 7 IVVDFTASWCGPCRFIAPILAEIAKKIPEVIFLKVDIDEVKSV 49 >gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthamiana] Length = 119 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCRFIAP+LA+IAKK P VIFLKVDVDELKTV Sbjct: 30 VVVDFTASWCGPCRFIAPVLADIAKKMPHVIFLKVDVDELKTV 72 >ref|XP_003589341.1| Thioredoxin H-type [Medicago truncatula] gi|74058514|gb|AAZ98843.1| thioredoxin h2 [Medicago truncatula] gi|355478389|gb|AES59592.1| Thioredoxin H-type [Medicago truncatula] Length = 120 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 +VVDFTASWCGPCRFIAPILAEIAKK PEVIFLKVD+DE+K+V Sbjct: 31 IVVDFTASWCGPCRFIAPILAEIAKKIPEVIFLKVDIDEVKSV 73 >gb|AAQ23134.1| thioredoxin H1 [Ipomoea batatas] Length = 108 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = -2 Query: 148 RGSCDQVVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 R S VVDFTASWCGPCRFIAPILA++AKKTP VIFLKVDVDELK+V Sbjct: 25 RASGKLTVVDFTASWCGPCRFIAPILADMAKKTPHVIFLKVDVDELKSV 73 >ref|XP_007223789.1| hypothetical protein PRUPE_ppa013161mg [Prunus persica] gi|16588843|gb|AAL26915.1|AF323593_1 thioredoxin H [Prunus persica] gi|462420725|gb|EMJ24988.1| hypothetical protein PRUPE_ppa013161mg [Prunus persica] Length = 136 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VVVDFTASWCGPCR IAPILAE+AKKTPEV FLKVDVDEL+TV Sbjct: 30 VVVDFTASWCGPCRLIAPILAELAKKTPEVTFLKVDVDELRTV 72 >ref|XP_004500971.1| PREDICTED: thioredoxin H-type-like [Cicer arietinum] Length = 113 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 +VVDFTASWCGPCRFIAPILAEIAKK P V FLKVDVDELKTV Sbjct: 31 IVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDVDELKTV 73 >ref|XP_004291829.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 122 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 +VVDFTASWCGPCRFIAPILAE+AKKTP+V FLKVDVDELK V Sbjct: 31 IVVDFTASWCGPCRFIAPILAELAKKTPDVTFLKVDVDELKKV 73 >emb|CAH59450.1| thioredoxin 1 [Plantago major] Length = 119 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -2 Query: 130 VVVDFTASWCGPCRFIAPILAEIAKKTPEVIFLKVDVDELKTV 2 VV+DFTASWCGPCRFIAPILAE+AKKTP V+FLKVDVDELK + Sbjct: 33 VVIDFTASWCGPCRFIAPILAELAKKTPHVMFLKVDVDELKAI 75