BLASTX nr result
ID: Mentha26_contig00002333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00002333 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24528.1| hypothetical protein MIMGU_mgv1a016563mg [Mimulus... 56 5e-06 >gb|EYU24528.1| hypothetical protein MIMGU_mgv1a016563mg [Mimulus guttatus] Length = 116 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 456 DKLFERNTQSGSFYLQSKVVRAKECLESVEKPKK 355 D LFERN +SGSFYLQSKV RAKECLE++ +PK+ Sbjct: 77 DNLFERNAKSGSFYLQSKVHRAKECLETIHQPKE 110