BLASTX nr result
ID: Mentha26_contig00002215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00002215 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21772.1| hypothetical protein MIMGU_mgv1a011557mg [Mimulus... 83 5e-14 gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] 79 5e-13 gb|ABG35768.1| NOX3 [Striga asiatica] 79 5e-13 gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Mimulus... 75 1e-11 gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta] 74 2e-11 gb|EYU24552.1| hypothetical protein MIMGU_mgv1a001077mg [Mimulus... 70 3e-10 ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus... 69 7e-10 gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus n... 68 2e-09 ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog... 68 2e-09 ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citr... 68 2e-09 ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog... 67 2e-09 gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta] 66 4e-09 ref|XP_002318793.2| respiratory burst oxidase C family protein [... 66 4e-09 ref|XP_002322314.2| respiratory burst oxidase C family protein [... 66 4e-09 ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog... 66 6e-09 ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citr... 66 6e-09 ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medi... 66 6e-09 gb|AFW64933.1| respiratory burst oxidase protein D variant alpha... 65 1e-08 gb|AFW64932.1| respiratory burst oxidase protein D variant beta ... 65 1e-08 ref|NP_001157759.1| LOC100136880 isoform 1 [Zea mays] gi|2099816... 65 1e-08 >gb|EYU21772.1| hypothetical protein MIMGU_mgv1a011557mg [Mimulus guttatus] Length = 277 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD Sbjct: 225 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 261 >gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] Length = 887 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WRTVYKRIALNHP +RVGVFYCGAPPPVKELRQLASD Sbjct: 835 WRTVYKRIALNHPETRVGVFYCGAPPPVKELRQLASD 871 >gb|ABG35768.1| NOX3 [Striga asiatica] Length = 542 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WRTVYKRIALNHP +RVGVFYCGAPPPVKELRQLASD Sbjct: 473 WRTVYKRIALNHPTARVGVFYCGAPPPVKELRQLASD 509 >gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Mimulus guttatus] Length = 916 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYK IA+NHPN+RVGVFYCGAPPPV+ELRQLASD Sbjct: 864 WREVYKSIAVNHPNARVGVFYCGAPPPVRELRQLASD 900 >gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta] Length = 908 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WRTVYKRIALNHPNSRVGVFYCGAP KELRQLASD Sbjct: 856 WRTVYKRIALNHPNSRVGVFYCGAPALTKELRQLASD 892 >gb|EYU24552.1| hypothetical protein MIMGU_mgv1a001077mg [Mimulus guttatus] Length = 894 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLAS 110 WRTVYKRIALNHP + VGVF+CGAP PVKELRQLAS Sbjct: 842 WRTVYKRIALNHPETTVGVFFCGAPAPVKELRQLAS 877 >ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus communis] gi|223550174|gb|EEF51661.1| respiratory burst oxidase, putative [Ricinus communis] Length = 910 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR+VYKR ALNHPNSRVGVFYCGAP KELR LASD Sbjct: 858 WRSVYKRTALNHPNSRVGVFYCGAPALTKELRHLASD 894 >gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus notabilis] Length = 924 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKRIAL HP+SRVGVFYCGAP KELRQLASD Sbjct: 872 WRQVYKRIALQHPHSRVGVFYCGAPALTKELRQLASD 908 >ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Citrus sinensis] Length = 915 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKRIAL+HP+SR+GVFYCGAP KELRQLASD Sbjct: 863 WRQVYKRIALHHPDSRIGVFYCGAPALTKELRQLASD 899 >ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citrus clementina] gi|557525818|gb|ESR37124.1| hypothetical protein CICLE_v10027774mg [Citrus clementina] Length = 912 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKRIAL+HP+SR+GVFYCGAP KELRQLASD Sbjct: 860 WRQVYKRIALHHPDSRIGVFYCGAPALTKELRQLASD 896 >ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer arietinum] Length = 927 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR+VYKRIALNHP +RVGVFYCG P KELRQLASD Sbjct: 875 WRSVYKRIALNHPQARVGVFYCGLPALAKELRQLASD 911 >gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta] Length = 882 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKRIALNHP+SRVGVFYCGAP KELR LA D Sbjct: 830 WRNVYKRIALNHPDSRVGVFYCGAPALTKELRHLALD 866 >ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550326872|gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 909 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKR ALNHP+SRVGVFYCGAP KELRQLA D Sbjct: 857 WRNVYKRTALNHPDSRVGVFYCGAPALTKELRQLALD 893 >ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550322544|gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 915 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKR ALNHP+SRVGVFYCGAP KELRQLA D Sbjct: 863 WRNVYKRTALNHPDSRVGVFYCGAPALTKELRQLALD 899 >ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Citrus sinensis] Length = 929 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKR+ALNHP+SRVGVFYCGAP KELR LA D Sbjct: 877 WRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALD 913 >ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citrus clementina] gi|557539204|gb|ESR50248.1| hypothetical protein CICLE_v10030649mg [Citrus clementina] Length = 929 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKR+ALNHP+SRVGVFYCGAP KELR LA D Sbjct: 877 WRNVYKRVALNHPDSRVGVFYCGAPALTKELRHLALD 913 >ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medicago truncatula] gi|355491774|gb|AES72977.1| Respiratory burst oxidase-like protein [Medicago truncatula] Length = 923 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR+VYKRIALNHP +RVGVFYCG P KELRQL SD Sbjct: 871 WRSVYKRIALNHPQTRVGVFYCGPPALTKELRQLGSD 907 >gb|AFW64933.1| respiratory burst oxidase protein D variant alpha [Zea mays] Length = 932 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKRIALNH N RVGVFYCGAP KELR+LA D Sbjct: 880 WRNVYKRIALNHQNQRVGVFYCGAPVLTKELRELAQD 916 >gb|AFW64932.1| respiratory burst oxidase protein D variant beta [Zea mays] Length = 648 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKRIALNH N RVGVFYCGAP KELR+LA D Sbjct: 596 WRNVYKRIALNHQNQRVGVFYCGAPVLTKELRELAQD 632 >ref|NP_001157759.1| LOC100136880 isoform 1 [Zea mays] gi|209981681|gb|ACJ05393.1| respiratory burst oxidase protein D variant alpha [Zea mays] Length = 932 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +3 Query: 3 WRTVYKRIALNHPNSRVGVFYCGAPPPVKELRQLASD 113 WR VYKRIALNH N RVGVFYCGAP KELR+LA D Sbjct: 880 WRNVYKRIALNHQNQRVGVFYCGAPVLTKELRELAQD 916