BLASTX nr result
ID: Mentha26_contig00001862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00001862 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45593.1| hypothetical protein MIMGU_mgv1a012297mg [Mimulus... 57 2e-06 >gb|EYU45593.1| hypothetical protein MIMGU_mgv1a012297mg [Mimulus guttatus] Length = 254 Score = 57.4 bits (137), Expect = 2e-06 Identities = 40/95 (42%), Positives = 49/95 (51%), Gaps = 3/95 (3%) Frame = -1 Query: 393 RDRGYGASDGRYSGHRSRSMSRSASPKVE---XXXXXXXXXXXXXXXXXSPQDEEIHRPS 223 R +GYGA D +S RSRS+SRS SP+ E SP DE+ HR Sbjct: 161 RGKGYGARDDYHSPRRSRSISRSVSPRNERNHRSREKPTRRSRSFSRSVSPLDEKNHRQI 220 Query: 222 VRSPSPRENGRFGYGSRSQSPRRNSMSPVSRR*RS 118 RS +P+EN RS+SP+RNS SP R RS Sbjct: 221 RRSTNPKEN-----APRSRSPKRNSRSPSRSRSRS 250