BLASTX nr result
ID: Mentha26_contig00001777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00001777 (721 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007218398.1| hypothetical protein PRUPE_ppa011401mg [Prun... 59 1e-06 >ref|XP_007218398.1| hypothetical protein PRUPE_ppa011401mg [Prunus persica] gi|462414860|gb|EMJ19597.1| hypothetical protein PRUPE_ppa011401mg [Prunus persica] Length = 212 Score = 59.3 bits (142), Expect = 1e-06 Identities = 37/89 (41%), Positives = 55/89 (61%), Gaps = 11/89 (12%) Frame = -2 Query: 354 SMSAKSRRRMFMFGPVKFKPEMELSAIKQRQGKMPLA--------AEKAAPQ--PSGGGK 205 S S+ SR+ + G VK++PEM+LS I++RQ + A E++A SG GK Sbjct: 121 SPSSNSRKHKVLIGLVKYQPEMDLSEIRKRQSRRAPAPMFPVINGGEQSAVTGGKSGSGK 180 Query: 204 SHWGVVKSSLRGRSHLVSMLAR-SLGCIP 121 HWG+++ LR SHL+S LA+ +LGC+P Sbjct: 181 GHWGLMR-PLRCPSHLLSALAKATLGCVP 208