BLASTX nr result
ID: Mentha26_contig00001776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00001776 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33815.1| hypothetical protein MIMGU_mgv1a006363mg [Mimulus... 84 2e-14 gb|EPS58082.1| hypothetical protein M569_16734, partial [Genlise... 83 5e-14 ref|XP_003635521.1| PREDICTED: uncharacterized WD repeat-contain... 82 8e-14 emb|CBI41088.3| unnamed protein product [Vitis vinifera] 82 8e-14 ref|XP_006474763.1| PREDICTED: uncharacterized WD repeat-contain... 80 3e-13 ref|XP_006474762.1| PREDICTED: uncharacterized WD repeat-contain... 80 3e-13 ref|XP_006452768.1| hypothetical protein CICLE_v10008133mg [Citr... 80 3e-13 ref|XP_006452766.1| hypothetical protein CICLE_v10008133mg [Citr... 80 3e-13 gb|EYU27616.1| hypothetical protein MIMGU_mgv1a006397mg [Mimulus... 79 5e-13 ref|XP_006467253.1| PREDICTED: uncharacterized WD repeat-contain... 79 9e-13 ref|XP_006449956.1| hypothetical protein CICLE_v10015233mg [Citr... 79 9e-13 ref|XP_002264198.1| PREDICTED: uncharacterized WD repeat-contain... 79 9e-13 emb|CAN73799.1| hypothetical protein VITISV_017109 [Vitis vinifera] 79 9e-13 ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Popu... 78 1e-12 ref|XP_002525241.1| WD-repeat protein, putative [Ricinus communi... 77 2e-12 ref|XP_006378005.1| WD-40 repeat family protein [Populus trichoc... 77 3e-12 ref|XP_006373547.1| hypothetical protein POPTR_0016s00280g [Popu... 77 3e-12 ref|XP_002299079.1| WD-40 repeat family protein [Populus trichoc... 77 3e-12 ref|XP_007207325.1| hypothetical protein PRUPE_ppa005817mg [Prun... 76 6e-12 ref|XP_004149568.1| PREDICTED: uncharacterized WD repeat-contain... 76 6e-12 >gb|EYU33815.1| hypothetical protein MIMGU_mgv1a006363mg [Mimulus guttatus] Length = 447 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SGVSFSPDT+SLFIG+WDRTYGSLLQYNRCRN+SYLDSLM Sbjct: 408 SGVSFSPDTDSLFIGIWDRTYGSLLQYNRCRNYSYLDSLM 447 >gb|EPS58082.1| hypothetical protein M569_16734, partial [Genlisea aurea] Length = 166 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+SFSPDTESLFIGVWDRTYGSLLQYNRCRN+SYLDS++ Sbjct: 127 SGISFSPDTESLFIGVWDRTYGSLLQYNRCRNYSYLDSII 166 >ref|XP_003635521.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like, partial [Vitis vinifera] Length = 314 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRN+ YLDSL+ Sbjct: 275 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNYLYLDSLL 314 >emb|CBI41088.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRN+ YLDSL+ Sbjct: 284 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNYLYLDSLL 323 >ref|XP_006474763.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Citrus sinensis] Length = 446 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+SFSPDTESLFIGVWDRTYGSLL+Y RCRN+SYLDSL+ Sbjct: 407 SGISFSPDTESLFIGVWDRTYGSLLEYGRCRNYSYLDSLI 446 >ref|XP_006474762.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Citrus sinensis] Length = 485 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+SFSPDTESLFIGVWDRTYGSLL+Y RCRN+SYLDSL+ Sbjct: 446 SGISFSPDTESLFIGVWDRTYGSLLEYGRCRNYSYLDSLI 485 >ref|XP_006452768.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|557555994|gb|ESR66008.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] Length = 485 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+SFSPDTESLFIGVWDRTYGSLL+Y RCRN+SYLDSL+ Sbjct: 446 SGISFSPDTESLFIGVWDRTYGSLLEYGRCRNYSYLDSLI 485 >ref|XP_006452766.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|567921522|ref|XP_006452767.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|557555992|gb|ESR66006.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] gi|557555993|gb|ESR66007.1| hypothetical protein CICLE_v10008133mg [Citrus clementina] Length = 446 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+SFSPDTESLFIGVWDRTYGSLL+Y RCRN+SYLDSL+ Sbjct: 407 SGISFSPDTESLFIGVWDRTYGSLLEYGRCRNYSYLDSLI 446 >gb|EYU27616.1| hypothetical protein MIMGU_mgv1a006397mg [Mimulus guttatus] Length = 445 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLD 373 SGVSFSPDT+SLFIGVWDRTYGSLLQYNRCRN+SYLD Sbjct: 408 SGVSFSPDTDSLFIGVWDRTYGSLLQYNRCRNYSYLD 444 >ref|XP_006467253.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Citrus sinensis] Length = 448 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/40 (82%), Positives = 40/40 (100%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG++FSPDTE+LFIGVWDRTYGSLLQYNRCRN++YLD+L+ Sbjct: 409 SGMTFSPDTEALFIGVWDRTYGSLLQYNRCRNYTYLDTLL 448 >ref|XP_006449956.1| hypothetical protein CICLE_v10015233mg [Citrus clementina] gi|557552567|gb|ESR63196.1| hypothetical protein CICLE_v10015233mg [Citrus clementina] Length = 448 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/40 (82%), Positives = 40/40 (100%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG++FSPDTE+LFIGVWDRTYGSLLQYNRCRN++YLD+L+ Sbjct: 409 SGMTFSPDTEALFIGVWDRTYGSLLQYNRCRNYTYLDTLL 448 >ref|XP_002264198.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03 [Vitis vinifera] gi|296090035|emb|CBI39854.3| unnamed protein product [Vitis vinifera] Length = 442 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+ FSPDTESLFIGVWDRTYGSL++YNRCRN++YLDSL+ Sbjct: 403 SGICFSPDTESLFIGVWDRTYGSLMEYNRCRNYAYLDSLI 442 >emb|CAN73799.1| hypothetical protein VITISV_017109 [Vitis vinifera] Length = 234 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+ FSPDTESLFIGVWDRTYGSL++YNRCRN++YLDSL+ Sbjct: 195 SGICFSPDTESLFIGVWDRTYGSLMEYNRCRNYAYLDSLI 234 >ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] gi|222854709|gb|EEE92256.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] Length = 448 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SGVSFSPDTESLFIGVWDRTYGSLLQYNR R++SY+DSLM Sbjct: 409 SGVSFSPDTESLFIGVWDRTYGSLLQYNRRRSYSYVDSLM 448 >ref|XP_002525241.1| WD-repeat protein, putative [Ricinus communis] gi|223535538|gb|EEF37207.1| WD-repeat protein, putative [Ricinus communis] Length = 438 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SGVSFSPDTESLFIGVWDRTYGSLLQYNR RN+++LDS M Sbjct: 399 SGVSFSPDTESLFIGVWDRTYGSLLQYNRSRNYTFLDSFM 438 >ref|XP_006378005.1| WD-40 repeat family protein [Populus trichocarpa] gi|550328611|gb|ERP55802.1| WD-40 repeat family protein [Populus trichocarpa] Length = 445 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SGVSFSPDTE+L+IGVWDRTYGSLL+Y RCRN+SYLDS + Sbjct: 406 SGVSFSPDTEALYIGVWDRTYGSLLEYGRCRNYSYLDSFV 445 >ref|XP_006373547.1| hypothetical protein POPTR_0016s00280g [Populus trichocarpa] gi|550320457|gb|ERP51344.1| hypothetical protein POPTR_0016s00280g [Populus trichocarpa] Length = 143 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 S VSFSPDTESLFIGVWDR YGSL QYNRCR++SYLDSLM Sbjct: 104 SVVSFSPDTESLFIGVWDRNYGSLFQYNRCRSYSYLDSLM 143 >ref|XP_002299079.1| WD-40 repeat family protein [Populus trichocarpa] gi|222846337|gb|EEE83884.1| WD-40 repeat family protein [Populus trichocarpa] Length = 445 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SGVSFSPDTE+L+IGVWDRTYGSLL+Y RCRN+SYLDS + Sbjct: 406 SGVSFSPDTEALYIGVWDRTYGSLLEYGRCRNYSYLDSFV 445 >ref|XP_007207325.1| hypothetical protein PRUPE_ppa005817mg [Prunus persica] gi|462402967|gb|EMJ08524.1| hypothetical protein PRUPE_ppa005817mg [Prunus persica] Length = 442 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSLM 364 SG+SFSPDTESLFIGVWDRTYGSLL+Y R RN+SYLDSL+ Sbjct: 403 SGISFSPDTESLFIGVWDRTYGSLLEYGRYRNYSYLDSLI 442 >ref|XP_004149568.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Cucumis sativus] gi|449526670|ref|XP_004170336.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Cucumis sativus] Length = 445 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 483 SGVSFSPDTESLFIGVWDRTYGSLLQYNRCRNHSYLDSL 367 SGVSFSPDTESLFIGVWDRTYGSLL+Y+R RN+SYLDSL Sbjct: 406 SGVSFSPDTESLFIGVWDRTYGSLLEYHRRRNYSYLDSL 444