BLASTX nr result
ID: Mentha26_contig00001645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00001645 (783 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20802.1| hypothetical protein MIMGU_mgv1a021747mg, partial... 60 9e-07 ref|XP_003538246.2| PREDICTED: nudix hydrolase 16, mitochondrial... 59 2e-06 ref|XP_006477497.1| PREDICTED: nudix hydrolase 16, mitochondrial... 59 2e-06 ref|XP_007202583.1| hypothetical protein PRUPE_ppa011588mg [Prun... 59 2e-06 ref|XP_006421099.1| hypothetical protein CICLE_v100059351mg, par... 59 2e-06 ref|XP_007010920.1| Nudix hydrolase [Theobroma cacao] gi|5087278... 59 2e-06 ref|XP_007218492.1| hypothetical protein PRUPE_ppa012156mg [Prun... 59 3e-06 ref|XP_003546710.1| PREDICTED: nudix hydrolase 16, mitochondrial... 58 4e-06 ref|XP_003542815.1| PREDICTED: nudix hydrolase 16, mitochondrial... 58 4e-06 gb|EYU18631.1| hypothetical protein MIMGU_mgv1a014732mg [Mimulus... 57 6e-06 ref|XP_004307090.1| PREDICTED: nudix hydrolase 16, mitochondrial... 57 8e-06 ref|XP_004249309.1| PREDICTED: nudix hydrolase 16, mitochondrial... 57 8e-06 ref|XP_007133744.1| hypothetical protein PHAVU_011G205700g [Phas... 57 1e-05 ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial... 57 1e-05 >gb|EYU20802.1| hypothetical protein MIMGU_mgv1a021747mg, partial [Mimulus guttatus] Length = 168 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKN-SEDGDGTPEKVVEVLMINSTSGPGLLFPK 604 IPFKY+N +E+GD T EK+VEVLMINST GPGLLFPK Sbjct: 26 IPFKYRNVTENGDDTSEKMVEVLMINSTGGPGLLFPK 62 >ref|XP_003538246.2| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max] Length = 175 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 497 IPFKYKNSEDGDGTPEKVVEVLMINSTSGPGLLFPK 604 +PF+YK + GD EK+VEVLMINSTSGPGLLFPK Sbjct: 27 VPFRYKEDDCGDSCSEKIVEVLMINSTSGPGLLFPK 62 >ref|XP_006477497.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Citrus sinensis] Length = 198 Score = 59.3 bits (142), Expect = 2e-06 Identities = 30/44 (68%), Positives = 32/44 (72%), Gaps = 8/44 (18%) Frame = +2 Query: 497 IPFKYKNSE--------DGDGTPEKVVEVLMINSTSGPGLLFPK 604 IPFKY+N DGDG EK+VEVLMINSTSGPGLLFPK Sbjct: 26 IPFKYRNRNCEEGDGDGDGDGRSEKIVEVLMINSTSGPGLLFPK 69 >ref|XP_007202583.1| hypothetical protein PRUPE_ppa011588mg [Prunus persica] gi|462398114|gb|EMJ03782.1| hypothetical protein PRUPE_ppa011588mg [Prunus persica] Length = 205 Score = 59.3 bits (142), Expect = 2e-06 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNS-EDGDGTPEKVVEVLMINSTSGPGLLFPK 604 IPFKY N E+ DGT EKVVEVLMINSTSGPGL+FPK Sbjct: 26 IPFKYTNLVENSDGTHEKVVEVLMINSTSGPGLVFPK 62 >ref|XP_006421099.1| hypothetical protein CICLE_v100059351mg, partial [Citrus clementina] gi|557522972|gb|ESR34339.1| hypothetical protein CICLE_v100059351mg, partial [Citrus clementina] Length = 69 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/44 (68%), Positives = 32/44 (72%), Gaps = 8/44 (18%) Frame = +2 Query: 497 IPFKYKNSE--------DGDGTPEKVVEVLMINSTSGPGLLFPK 604 IPFKY+N DGDG EK+VEVLMINSTSGPGLLFPK Sbjct: 26 IPFKYRNRNCEEGDCDGDGDGGSEKIVEVLMINSTSGPGLLFPK 69 >ref|XP_007010920.1| Nudix hydrolase [Theobroma cacao] gi|508727833|gb|EOY19730.1| Nudix hydrolase [Theobroma cacao] Length = 206 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +2 Query: 497 IPFKYKNSEDGDGTPEKVVEVLMINSTSGPGLLFPK 604 IPF+Y++S++ D EKVVEVLMINSTSGPGLLFPK Sbjct: 63 IPFRYRSSDETDVNSEKVVEVLMINSTSGPGLLFPK 98 >ref|XP_007218492.1| hypothetical protein PRUPE_ppa012156mg [Prunus persica] gi|462414954|gb|EMJ19691.1| hypothetical protein PRUPE_ppa012156mg [Prunus persica] Length = 181 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/37 (72%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNSED-GDGTPEKVVEVLMINSTSGPGLLFPK 604 IPF+YKNS++ GD EK++EVLMINS SGPGLLFPK Sbjct: 26 IPFRYKNSDETGDANSEKIIEVLMINSPSGPGLLFPK 62 >ref|XP_003546710.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max] Length = 175 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/37 (72%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNSED-GDGTPEKVVEVLMINSTSGPGLLFPK 604 +PF+YK+S D GD + EK+VEVLMINS SGPGLLFPK Sbjct: 26 VPFRYKSSNDCGDSSSEKIVEVLMINSPSGPGLLFPK 62 >ref|XP_003542815.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max] Length = 175 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/37 (72%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNSED-GDGTPEKVVEVLMINSTSGPGLLFPK 604 +PF+YK+S D GD + EK+VEVLMINS SGPGLLFPK Sbjct: 26 VPFRYKSSNDCGDSSSEKIVEVLMINSPSGPGLLFPK 62 >gb|EYU18631.1| hypothetical protein MIMGU_mgv1a014732mg [Mimulus guttatus] Length = 180 Score = 57.4 bits (137), Expect = 6e-06 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNSEDGD-GTPEKVVEVLMINSTSGPGLLFPK 604 IPFKY ED + GT EK+VEVLMINSTSGPGLLFPK Sbjct: 26 IPFKYTYVEDDECGTSEKIVEVLMINSTSGPGLLFPK 62 >ref|XP_004307090.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 174 Score = 57.0 bits (136), Expect = 8e-06 Identities = 28/37 (75%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNS-EDGDGTPEKVVEVLMINSTSGPGLLFPK 604 IPF+Y+NS E G+ EKVVEVLMINS+SGPGLLFPK Sbjct: 26 IPFRYRNSDESGNADSEKVVEVLMINSSSGPGLLFPK 62 >ref|XP_004249309.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Solanum lycopersicum] Length = 179 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/37 (72%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNSE-DGDGTPEKVVEVLMINSTSGPGLLFPK 604 IPF++++ E +GD T EK+VEVLMINSTSGPGLLFPK Sbjct: 26 IPFRFRDMEQNGDDTSEKIVEVLMINSTSGPGLLFPK 62 >ref|XP_007133744.1| hypothetical protein PHAVU_011G205700g [Phaseolus vulgaris] gi|561006744|gb|ESW05738.1| hypothetical protein PHAVU_011G205700g [Phaseolus vulgaris] Length = 172 Score = 56.6 bits (135), Expect = 1e-05 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 497 IPFKYKNSEDGDGTPEKVVEVLMINSTSGPGLLFPK 604 +PF+YK+S DGD + EK+VEVL+INS SGPGLLFPK Sbjct: 26 VPFRYKSS-DGDSSSEKIVEVLLINSPSGPGLLFPK 60 >ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi|147852980|emb|CAN81261.1| hypothetical protein VITISV_019710 [Vitis vinifera] gi|297739943|emb|CBI30125.3| unnamed protein product [Vitis vinifera] Length = 182 Score = 56.6 bits (135), Expect = 1e-05 Identities = 27/37 (72%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +2 Query: 497 IPFKYKNSEDGDGTP-EKVVEVLMINSTSGPGLLFPK 604 IPFKY+NS + +G +K+VEVLMINSTSGPGLLFPK Sbjct: 26 IPFKYRNSVESNGAASQKIVEVLMINSTSGPGLLFPK 62