BLASTX nr result
ID: Mentha26_contig00001448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00001448 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22977.1| hypothetical protein MIMGU_mgv1a004959mg [Mimulus... 62 8e-08 >gb|EYU22977.1| hypothetical protein MIMGU_mgv1a004959mg [Mimulus guttatus] Length = 502 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3 Query: 210 YFRSATGDQLLYDGDRTKDDIIDFIKKNRAAVAAPVRQESRNEEL 344 YFRS+TG+ L YDGDRTK D+IDFI+KNRA VA +QES N+EL Sbjct: 461 YFRSSTGNLLQYDGDRTKQDMIDFIQKNRATVA---KQESANDEL 502