BLASTX nr result
ID: Mentha26_contig00001411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00001411 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22815.1| hypothetical protein MIMGU_mgv1a006425mg [Mimulus... 72 8e-11 >gb|EYU22815.1| hypothetical protein MIMGU_mgv1a006425mg [Mimulus guttatus] Length = 444 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/55 (60%), Positives = 37/55 (67%) Frame = -3 Query: 180 NMGNTFWMLPVTGGGSTATAAQQEWQYRQSSMQRAGCFEXXXXXXXSPVQFGSMV 16 N+GN FWM+PVTG TAT QQEW Y+ SSMQR G FE +PVQ GSMV Sbjct: 299 NVGNAFWMMPVTGSAGTATVGQQEWPYKASSMQRIGGFEFPGVGRFNPVQLGSMV 353