BLASTX nr result
ID: Mentha26_contig00000929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00000929 (627 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC32449.1| hypothetical protein L484_012616 [Morus notabilis] 62 1e-07 >gb|EXC32449.1| hypothetical protein L484_012616 [Morus notabilis] Length = 76 Score = 62.4 bits (150), Expect = 1e-07 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 3/73 (4%) Frame = -2 Query: 584 WRNRCLVLSLL-ALVFMSEASRLPKAYNWEQMXXXXXXXXXXXXSRGTNSV--TASSKAV 414 WR +CL L+L+ ALV +SEASRLPK+ +WEQM S+GTNSV ++SSK V Sbjct: 5 WRQKCLFLTLIFALVILSEASRLPKS-SWEQMLPKKLPSPNSSPSKGTNSVSTSSSSKEV 63 Query: 413 EMDQKLLSDDGKV 375 +D+ L S DGKV Sbjct: 64 NVDKNLPSSDGKV 76