BLASTX nr result
ID: Mentha26_contig00000800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00000800 (817 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37137.1| hypothetical protein L484_018560 [Morus notabilis] 135 2e-29 gb|AFK40379.1| unknown [Medicago truncatula] 135 2e-29 ref|XP_003603935.1| Transcription factor BEE [Medicago truncatul... 135 2e-29 ref|XP_002313497.2| hypothetical protein POPTR_0009s12000g [Popu... 134 3e-29 ref|XP_006878569.1| hypothetical protein AMTR_s00011p00241810 [A... 134 3e-29 ref|XP_007199864.1| hypothetical protein PRUPE_ppa005829mg [Prun... 134 3e-29 ref|XP_002313791.1| basic helix-loop-helix family protein [Popul... 134 3e-29 ref|XP_007042174.1| Cryptochrome-interacting basic-helix-loop-he... 134 4e-29 ref|XP_007042173.1| Cryptochrome-interacting basic-helix-loop-he... 134 4e-29 ref|XP_007042172.1| Cryptochrome-interacting basic-helix-loop-he... 134 4e-29 ref|XP_007042171.1| Cryptochrome-interacting basic-helix-loop-he... 134 4e-29 ref|XP_007042170.1| Cryptochrome-interacting basic-helix-loop-he... 134 4e-29 ref|XP_007042169.1| Cryptochrome-interacting basic-helix-loop-he... 134 4e-29 ref|XP_004289668.1| PREDICTED: transcription factor bHLH63-like ... 134 5e-29 ref|XP_004173629.1| PREDICTED: transcription factor bHLH63-like ... 134 5e-29 ref|XP_004148552.1| PREDICTED: transcription factor bHLH63-like ... 134 5e-29 ref|XP_002512912.1| conserved hypothetical protein [Ricinus comm... 133 9e-29 ref|XP_006469146.1| PREDICTED: transcription factor bHLH63-like ... 132 2e-28 ref|XP_006469145.1| PREDICTED: transcription factor bHLH63-like ... 132 2e-28 ref|XP_006423284.1| hypothetical protein CICLE_v10028494mg [Citr... 132 2e-28 >gb|EXB37137.1| hypothetical protein L484_018560 [Morus notabilis] Length = 470 Score = 135 bits (340), Expect = 2e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 234 SKENSKASEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 293 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 294 AGMLDEIINYVQSL 307 >gb|AFK40379.1| unknown [Medicago truncatula] Length = 397 Score = 135 bits (340), Expect = 2e-29 Identities = 66/74 (89%), Positives = 71/74 (95%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK ++ KTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 174 SKENSKVSDVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 233 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 234 AGMLDEIINYVQSL 247 >ref|XP_003603935.1| Transcription factor BEE [Medicago truncatula] gi|355492983|gb|AES74186.1| Transcription factor BEE [Medicago truncatula] Length = 398 Score = 135 bits (340), Expect = 2e-29 Identities = 66/74 (89%), Positives = 71/74 (95%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK ++ KTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 174 SKENSKVSDVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 233 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 234 AGMLDEIINYVQSL 247 >ref|XP_002313497.2| hypothetical protein POPTR_0009s12000g [Populus trichocarpa] gi|550331556|gb|EEE87452.2| hypothetical protein POPTR_0009s12000g [Populus trichocarpa] Length = 440 Score = 134 bits (338), Expect = 3e-29 Identities = 67/76 (88%), Positives = 69/76 (90%) Frame = +1 Query: 589 GPSKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVT 768 G SK +SK E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+T Sbjct: 218 GNSKDNSKVTEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKIT 277 Query: 769 GKAGMLDEIINYVQSL 816 GKAGMLDEIINYVQSL Sbjct: 278 GKAGMLDEIINYVQSL 293 >ref|XP_006878569.1| hypothetical protein AMTR_s00011p00241810 [Amborella trichopoda] gi|548831912|gb|ERM94714.1| hypothetical protein AMTR_s00011p00241810 [Amborella trichopoda] Length = 441 Score = 134 bits (338), Expect = 3e-29 Identities = 66/74 (89%), Positives = 69/74 (93%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 +K SSK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 224 TKDSSKASEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 283 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 284 AGMLDEIINYVQSL 297 >ref|XP_007199864.1| hypothetical protein PRUPE_ppa005829mg [Prunus persica] gi|462395264|gb|EMJ01063.1| hypothetical protein PRUPE_ppa005829mg [Prunus persica] Length = 441 Score = 134 bits (338), Expect = 3e-29 Identities = 66/74 (89%), Positives = 69/74 (93%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK +SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 223 SKDNSKASEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 282 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 283 AGMLDEIINYVQSL 296 >ref|XP_002313791.1| basic helix-loop-helix family protein [Populus trichocarpa] gi|222850199|gb|EEE87746.1| basic helix-loop-helix family protein [Populus trichocarpa] Length = 439 Score = 134 bits (338), Expect = 3e-29 Identities = 67/76 (88%), Positives = 69/76 (90%) Frame = +1 Query: 589 GPSKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVT 768 G SK +SK E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+T Sbjct: 218 GNSKDNSKVTEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKIT 277 Query: 769 GKAGMLDEIINYVQSL 816 GKAGMLDEIINYVQSL Sbjct: 278 GKAGMLDEIINYVQSL 293 >ref|XP_007042174.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 6, partial [Theobroma cacao] gi|508706109|gb|EOX98005.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 6, partial [Theobroma cacao] Length = 377 Score = 134 bits (337), Expect = 4e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 221 SKENSKVSEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 280 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 281 AGMLDEIINYVQSL 294 >ref|XP_007042173.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 5 [Theobroma cacao] gi|508706108|gb|EOX98004.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 5 [Theobroma cacao] Length = 301 Score = 134 bits (337), Expect = 4e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 221 SKENSKVSEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 280 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 281 AGMLDEIINYVQSL 294 >ref|XP_007042172.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 4 [Theobroma cacao] gi|508706107|gb|EOX98003.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 4 [Theobroma cacao] Length = 319 Score = 134 bits (337), Expect = 4e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 154 SKENSKVSEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 213 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 214 AGMLDEIINYVQSL 227 >ref|XP_007042171.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 3 [Theobroma cacao] gi|508706106|gb|EOX98002.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 3 [Theobroma cacao] Length = 418 Score = 134 bits (337), Expect = 4e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 221 SKENSKVSEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 280 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 281 AGMLDEIINYVQSL 294 >ref|XP_007042170.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 2, partial [Theobroma cacao] gi|508706105|gb|EOX98001.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 2, partial [Theobroma cacao] Length = 408 Score = 134 bits (337), Expect = 4e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 221 SKENSKVSEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 280 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 281 AGMLDEIINYVQSL 294 >ref|XP_007042169.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 1 [Theobroma cacao] gi|508706104|gb|EOX98000.1| Cryptochrome-interacting basic-helix-loop-helix 1, putative isoform 1 [Theobroma cacao] Length = 440 Score = 134 bits (337), Expect = 4e-29 Identities = 66/74 (89%), Positives = 70/74 (94%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 221 SKENSKVSEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 280 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 281 AGMLDEIINYVQSL 294 >ref|XP_004289668.1| PREDICTED: transcription factor bHLH63-like [Fragaria vesca subsp. vesca] Length = 422 Score = 134 bits (336), Expect = 5e-29 Identities = 66/74 (89%), Positives = 69/74 (93%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK +SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 201 SKGNSKASEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 260 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 261 AGMLDEIINYVQSL 274 >ref|XP_004173629.1| PREDICTED: transcription factor bHLH63-like [Cucumis sativus] Length = 456 Score = 134 bits (336), Expect = 5e-29 Identities = 65/74 (87%), Positives = 69/74 (93%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAER RREKISERMKYLQDLVPGCNK+TGK Sbjct: 232 SKENSKASEVQKPDYIHVRARRGQATDSHSLAERARREKISERMKYLQDLVPGCNKITGK 291 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 292 AGMLDEIINYVQSL 305 >ref|XP_004148552.1| PREDICTED: transcription factor bHLH63-like [Cucumis sativus] Length = 523 Score = 134 bits (336), Expect = 5e-29 Identities = 65/74 (87%), Positives = 69/74 (93%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK++SK +E K DYIHVRARRGQATDSHSLAER RREKISERMKYLQDLVPGCNK+TGK Sbjct: 232 SKENSKASEVQKPDYIHVRARRGQATDSHSLAERARREKISERMKYLQDLVPGCNKITGK 291 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 292 AGMLDEIINYVQSL 305 >ref|XP_002512912.1| conserved hypothetical protein [Ricinus communis] gi|223547923|gb|EEF49415.1| conserved hypothetical protein [Ricinus communis] Length = 444 Score = 133 bits (334), Expect = 9e-29 Identities = 66/74 (89%), Positives = 68/74 (91%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 SK +SK E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 217 SKDNSKVTEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 276 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 277 AGMLDEIINYVQSL 290 >ref|XP_006469146.1| PREDICTED: transcription factor bHLH63-like isoform X2 [Citrus sinensis] Length = 430 Score = 132 bits (332), Expect = 2e-28 Identities = 65/74 (87%), Positives = 68/74 (91%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 S +SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 215 SADTSKASEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 274 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 275 AGMLDEIINYVQSL 288 >ref|XP_006469145.1| PREDICTED: transcription factor bHLH63-like isoform X1 [Citrus sinensis] Length = 440 Score = 132 bits (332), Expect = 2e-28 Identities = 65/74 (87%), Positives = 68/74 (91%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 S +SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 225 SADTSKASEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 284 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 285 AGMLDEIINYVQSL 298 >ref|XP_006423284.1| hypothetical protein CICLE_v10028494mg [Citrus clementina] gi|557525218|gb|ESR36524.1| hypothetical protein CICLE_v10028494mg [Citrus clementina] Length = 430 Score = 132 bits (332), Expect = 2e-28 Identities = 65/74 (87%), Positives = 68/74 (91%) Frame = +1 Query: 595 SKQSSKGAEAPKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKVTGK 774 S +SK +E K DYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNK+TGK Sbjct: 225 SADTSKASEVQKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGK 284 Query: 775 AGMLDEIINYVQSL 816 AGMLDEIINYVQSL Sbjct: 285 AGMLDEIINYVQSL 298