BLASTX nr result
ID: Mentha26_contig00000682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00000682 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23219.1| hypothetical protein MIMGU_mgv1a019226mg [Mimulus... 71 1e-10 gb|EYU36517.1| hypothetical protein MIMGU_mgv1a009828mg [Mimulus... 66 4e-09 >gb|EYU23219.1| hypothetical protein MIMGU_mgv1a019226mg [Mimulus guttatus] Length = 318 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/56 (67%), Positives = 41/56 (73%), Gaps = 7/56 (12%) Frame = +3 Query: 120 TGEPESDGSGGLSPESELVFTEF-------AEEEQFGLDFGSLEKYPSYEIDWSAL 266 T EPESDGSGGLSPESEL F +F AEEE G + GSL KYPSYEIDW+AL Sbjct: 263 TVEPESDGSGGLSPESELRFPDFEFRVSGFAEEELPGWEMGSLPKYPSYEIDWAAL 318 >gb|EYU36517.1| hypothetical protein MIMGU_mgv1a009828mg [Mimulus guttatus] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = +3 Query: 132 ESDGSGGLSPESELVFTEFAEEEQFGLDFGSLEKYPSYEIDWSAL 266 ESDGSG SP S+L F EF EEEQ G + GSL KYPSYEIDW AL Sbjct: 286 ESDGSGVSSPVSDLTFIEFTEEEQPGWEIGSLPKYPSYEIDWDAL 330