BLASTX nr result
ID: Mentha26_contig00000222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00000222 (1228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27637.1| hypothetical protein MIMGU_mgv1a020254mg [Mimulus... 58 1e-05 >gb|EYU27637.1| hypothetical protein MIMGU_mgv1a020254mg [Mimulus guttatus] Length = 360 Score = 57.8 bits (138), Expect = 1e-05 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 5/70 (7%) Frame = -1 Query: 211 ACSSRIKLIGTARDNTSKNFYISDTEMSLEDYEAFFDESLD-DPEFFENGGVDTFFEV-- 41 A S+R+K + D + ISD E+S+EDY+A FDES D +FFENGG+++ FE+ Sbjct: 159 ASSTRVKHLEPVNDALYQELEISDMELSMEDYDAIFDESFDGSQQFFENGGINSLFEIGN 218 Query: 40 --EDLCGAER 17 D C +R Sbjct: 219 SNNDECKPQR 228