BLASTX nr result
ID: Mentha26_contig00000020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00000020 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40116.1| hypothetical protein MIMGU_mgv1a000334mg [Mimulus... 60 4e-07 >gb|EYU40116.1| hypothetical protein MIMGU_mgv1a000334mg [Mimulus guttatus] Length = 1245 Score = 59.7 bits (143), Expect = 4e-07 Identities = 41/87 (47%), Positives = 51/87 (58%), Gaps = 1/87 (1%) Frame = -3 Query: 303 YPLSKSWKQIKSKQRARQKEKETTHDAVKNQKKSEKQELNPHNEDENHEMEGGPSTRLRK 124 +PLS SWKQIK+K+ A Q + VK+Q K++KQ P EGGPSTRLRK Sbjct: 1027 FPLSSSWKQIKNKRGANQ-------EPVKSQPKTKKQIDEP---------EGGPSTRLRK 1070 Query: 123 RTKK-PSKDSGARLTKPKQVVKKQQRD 46 RTK K++G +K K KKQQ D Sbjct: 1071 RTKTLICKETGP--SKAKPAPKKQQND 1095