BLASTX nr result
ID: Mentha25_contig00058814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00058814 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45951.1| hypothetical protein MIMGU_mgv1a017670mg, partial... 71 2e-10 ref|XP_004242071.1| PREDICTED: uncharacterized protein LOC101249... 58 2e-06 >gb|EYU45951.1| hypothetical protein MIMGU_mgv1a017670mg, partial [Mimulus guttatus] Length = 276 Score = 70.9 bits (172), Expect = 2e-10 Identities = 45/88 (51%), Positives = 54/88 (61%), Gaps = 1/88 (1%) Frame = -3 Query: 380 QLERRKKLTEXXXXXXXXXXXTFEQLLRVEEAYWS-SNVSPGSGGRACREHEVCPAHCPS 204 QLER K+ E TFEQLLRV+EA+WS + SP G +E + P H Sbjct: 3 QLERPKRSYESPKTPRSHTSPTFEQLLRVDEAFWSPTTTSPAPGMNHDQEGYLSPTH--- 59 Query: 203 DTKKSVLSKVKDTAKKLRHSLSGRRKLE 120 KKSVL+KVK+ AKKLR+SLSGRRK E Sbjct: 60 -NKKSVLTKVKEKAKKLRYSLSGRRKHE 86 >ref|XP_004242071.1| PREDICTED: uncharacterized protein LOC101249738 [Solanum lycopersicum] Length = 401 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -3 Query: 314 FEQLLRVEEAYWSSNVSPGSGGRACREHEVCPAHCPSDTKKSVLSKVKDTAKKLRHSLSG 135 FEQLL E WS++ SP A +HE + P+ KKSV+SKVK+ AKKL+HSLSG Sbjct: 22 FEQLLPGNERSWSTSSSP----TAYYDHE---EYTPTHGKKSVISKVKEKAKKLKHSLSG 74 Query: 134 RRKLE 120 R+K++ Sbjct: 75 RKKMQ 79