BLASTX nr result
ID: Mentha25_contig00058761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00058761 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482974.1| PREDICTED: probable inactive purple acid pho... 58 2e-06 ref|XP_006438893.1| hypothetical protein CICLE_v10033461mg [Citr... 58 2e-06 gb|EYU46049.1| hypothetical protein MIMGU_mgv1a017799mg, partial... 56 5e-06 >ref|XP_006482974.1| PREDICTED: probable inactive purple acid phosphatase 27-like [Citrus sinensis] Length = 625 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 10 ISKFGYVRVHAKKQELDVEFVNADSRKVEDSFRFIK 117 ++KFGY+R HA KQE+ +EFVNAD+RKVEDSFR I+ Sbjct: 586 VAKFGYLRGHATKQEIQLEFVNADTRKVEDSFRIIR 621 >ref|XP_006438893.1| hypothetical protein CICLE_v10033461mg [Citrus clementina] gi|557541089|gb|ESR52133.1| hypothetical protein CICLE_v10033461mg [Citrus clementina] Length = 639 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 10 ISKFGYVRVHAKKQELDVEFVNADSRKVEDSFRFIK 117 ++KFGY+R HA KQE+ +EFVNAD+RKVEDSFR I+ Sbjct: 600 VAKFGYLRGHATKQEIQLEFVNADTRKVEDSFRIIR 635 >gb|EYU46049.1| hypothetical protein MIMGU_mgv1a017799mg, partial [Mimulus guttatus] Length = 547 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +1 Query: 10 ISKFGYVRVHAKKQELDVEFVNADSRKVEDSFRFIKS 120 +S+FGYVRVHA K EL VEFVNADSR +D+F+ ++S Sbjct: 511 VSEFGYVRVHATKNELSVEFVNADSRNTDDNFQIVRS 547