BLASTX nr result
ID: Mentha25_contig00058663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00058663 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ67627.1| hypothetical protein BGT96224_Ac31157 [Blumeria g... 74 3e-11 >gb|EPQ67627.1| hypothetical protein BGT96224_Ac31157 [Blumeria graminis f. sp. tritici 96224] Length = 565 Score = 73.6 bits (179), Expect = 3e-11 Identities = 41/102 (40%), Positives = 55/102 (53%) Frame = -3 Query: 372 KKLESIKLPRSPREILETLVGFIPPRPTLKLMTFKNQGSHYLSYKYQINALHEEDIFIEW 193 K L ++ +P +L LV +IPP + S ++ + D IEW Sbjct: 468 KYLRQLEYNDTPIYLLYNLVQYIPPNHNMT------------SSGENVSVELKNDRLIEW 515 Query: 192 TRDVYGEVGLLVSSEGGRQPLYWRPASLSKRQLYNALNTQKT 67 T+DVYGE+GLL+S+ GG+ P YWRP SLSKRQL L KT Sbjct: 516 TKDVYGEMGLLISNNGGKTPTYWRPGSLSKRQLSKYLLQDKT 557