BLASTX nr result
ID: Mentha25_contig00058228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00058228 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93654.1| Metal tolerance protein 4 [Morus notabilis] 57 2e-06 >gb|EXB93654.1| Metal tolerance protein 4 [Morus notabilis] Length = 409 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 328 SFNTLKCDFLSKLPEKLKKNLDPEALLHLHHVSKTSALSQG 206 SF +LKCDF SKLPEKL+ LDPEALLHL ++KTS L +G Sbjct: 33 SFTSLKCDFFSKLPEKLRSGLDPEALLHL-DLTKTSGLMEG 72